eF-site ID 3vhx-A
PDB Code 3vhx
Chain A

click to enlarge
Title The crystal structure of Arf6-MKLP1 (Mitotic kinesin-like protein 1) complex
Classification CELL CYCLE/SIGNALING PROTEIN
Compound ADP-ribosylation factor 6
Source Homo sapiens (Human) (KIF23_HUMAN)
Sequence A:  MEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVET
VTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA
DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS
NY
Description (1)  ADP-ribosylation factor 6, Kinesin-like protein KIF23


Functional site

1) chain A
residue 22
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

2) chain A
residue 23
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

3) chain A
residue 24
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

4) chain A
residue 25
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

5) chain A
residue 26
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

6) chain A
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

7) chain A
residue 28
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

8) chain A
residue 41
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

9) chain A
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

10) chain A
residue 66
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

11) chain A
residue 122
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

12) chain A
residue 123
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

13) chain A
residue 125
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

14) chain A
residue 126
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

15) chain A
residue 155
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

16) chain A
residue 156
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

17) chain A
residue 157
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GTP A 184
source : AC1

18) chain A
residue 27
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG A 185
source : AC2

19) chain A
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE MG A 185
source : AC2

20) chain A
residue 52-56
type NP_BIND
ligand
sequence VTYKN
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI1

21) chain A
residue 111-114
type NP_BIND
ligand
sequence EMRD
description GTP (By similarity).
source Swiss-Prot : SWS_FT_FI1

22) chain A
residue 20-29
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence GLDAAGKTTI
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

23) chain A
residue 41-44
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence TIPT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

24) chain A
residue 63-67
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence DVGGL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

25) chain A
residue 122-126
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence NKQDL
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184

26) chain A
residue 154-157
type binding
ligand GTP: GUANOSINE-5'-TRIPHOSPHATE
sequence SCAT
description GUANOSINE-5'-TRIPHOSPHATE binding site
source pdb_hetatom : GTP_3vhx_A_184


Display surface

Download
Links