eF-site ID 3vf2-A PDB Code 3vf2 Chain A click to enlarge Title Crystal structure of the O-carbamoyltransferase TobZ M473I variant in complex with carbamoyl phosphate and ADP Classification TRANSFERASE Compound O-carbamoyltransferase TobZ Source null (Q70IY1_STRSD) Sequence A:  MRVLGLNGWPRDFHDASAALLVDGRIAAFAEEERFTRKKH GYNTAPVQAAAFCLAQAGLTVDDLDAVAFGWDLPAMYRER LGGWPHSDSEALDILLPRDVFPRRTDPPLHFVQHHLAHAA SAYYFSGEDRGAVLIVDGQGEEECVTLAHAEGGKITVLDT VPGAWSLGFFYEHVSEYTGLGGDNPGKLMGLAAHGTTVDE TLSAFAFDSDGYRLNLIDPQARDPEDWDEYSVTERAWFAH LERIYRLPPNEFVRRYDPAKGRVVRDTRRDPYEYRDLAAT AQAALERAVFGLADSVLARTGERTLFVAGGVGLNATMNGK LLTRSTVDKMFVPPVASDIGVSLGAAAAVAVELGDRIAPM GDTAAWGPEFSPDQVRAALDRTGLAYREPANLEREVAALI ASGKVVGWAQGRGEVGPRALGQRSLLGSAHSPTMRDHINL RVKDREWWRPFAPSMLRSVSDQVLEVDADFPYIIMTTKVR AAYAERLPSVVHEDWSTRPQTVTEASNPRYHRMLTELGDL VGDPVCLNTSFNDRGEPIVSSPADALLTFSRLPIDALAVG PYLVTK Description Functional site 1) chain A residue 114 type sequence H description BINDING SITE FOR RESIDUE FE2 A 601 source : AC1 2) chain A residue 118 type sequence H description BINDING SITE FOR RESIDUE FE2 A 601 source : AC1 3) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE FE2 A 601 source : AC1 4) chain A residue 338 type sequence D description BINDING SITE FOR RESIDUE FE2 A 601 source : AC1 5) chain A residue 322 type sequence L description BINDING SITE FOR RESIDUE K A 602 source : AC2 6) chain A residue 324 type sequence R description BINDING SITE FOR RESIDUE K A 602 source : AC2 7) chain A residue 327 type sequence V description BINDING SITE FOR RESIDUE K A 602 source : AC2 8) chain A residue 418 type sequence R description BINDING SITE FOR RESIDUE CP A 603 source : AC3 9) chain A residue 419 type sequence A description BINDING SITE FOR RESIDUE CP A 603 source : AC3 10) chain A residue 445 type sequence R description BINDING SITE FOR RESIDUE CP A 603 source : AC3 11) chain A residue 473 type sequence I description BINDING SITE FOR RESIDUE CP A 603 source : AC3 12) chain A residue 528 type sequence N description BINDING SITE FOR RESIDUE CP A 603 source : AC3 13) chain A residue 529 type sequence T description BINDING SITE FOR RESIDUE CP A 603 source : AC3 14) chain A residue 530 type sequence S description BINDING SITE FOR RESIDUE CP A 603 source : AC3 15) chain A residue 14 type sequence H description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 16) chain A residue 71 type sequence W description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 17) chain A residue 114 type sequence H description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 18) chain A residue 118 type sequence H description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 19) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 20) chain A residue 138 type sequence G description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 21) chain A residue 139 type sequence Q description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 22) chain A residue 168 type sequence G description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 23) chain A residue 169 type sequence F description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 24) chain A residue 171 type sequence Y description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 25) chain A residue 172 type sequence E description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 26) chain A residue 185 type sequence P description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 27) chain A residue 310 type sequence G description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 28) chain A residue 311 type sequence V description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 29) chain A residue 313 type sequence L description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 30) chain A residue 314 type sequence N description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 31) chain A residue 337 type sequence S description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 32) chain A residue 338 type sequence D description BINDING SITE FOR RESIDUE ADP A 604 source : AC4 33) chain A residue 14 type ACT_SITE sequence H description Proton acceptor => ECO:0000305|PubMed:22383337 source Swiss-Prot : SWS_FT_FI1 34) chain A residue 12 type BINDING sequence D description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 35) chain A residue 114 type BINDING sequence H description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 36) chain A residue 118 type BINDING sequence H description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 37) chain A residue 137 type BINDING sequence D description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 38) chain A residue 172 type BINDING sequence E description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 39) chain A residue 228 type BINDING sequence D description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 40) chain A residue 338 type BINDING sequence D description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 41) chain A residue 498 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 42) chain A residue 528 type BINDING sequence N description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VET source Swiss-Prot : SWS_FT_FI2 43) chain A residue 39 type BINDING sequence K description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEZ source Swiss-Prot : SWS_FT_FI3 44) chain A residue 418 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEZ source Swiss-Prot : SWS_FT_FI3 45) chain A residue 449 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEZ source Swiss-Prot : SWS_FT_FI3 46) chain A residue 139 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEX source Swiss-Prot : SWS_FT_FI4 47) chain A residue 168 type BINDING sequence G description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEX source Swiss-Prot : SWS_FT_FI4 48) chain A residue 310 type BINDING sequence G description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEX source Swiss-Prot : SWS_FT_FI4 49) chain A residue 314 type BINDING sequence N description BINDING => ECO:0000269|PubMed:22383337, ECO:0007744|PDB:3VEX source Swiss-Prot : SWS_FT_FI4

Display surface Download Links