eF-site ID 3v8a-A
PDB Code 3v8a
Chain A

click to enlarge
Title Thaumatin by Classical Hanging Drop Vapour Diffusion after 18.1 MGy X-Ray dose at ESRF ID29 beamline (Worst Case)
Classification PLANT PROTEIN
Compound Thaumatin I
Source ORGANISM_COMMON: katemfe; ORGANISM_SCIENTIFIC: Thaumatococcus daniellii;
Sequence A:  ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTIN
VEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRF
GRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRG
CRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCT
TGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYR
VTFCPTA
Description (1)  Thaumatin I


Functional site

1) chain A
residue 89
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 301
source : AC1

2) chain A
residue 184
type
ligand
sequence V
description BINDING SITE FOR RESIDUE GOL A 301
source : AC1

3) chain A
residue 105
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

4) chain A
residue 147
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

5) chain A
residue 148
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

6) chain A
residue 149
type
ligand
sequence C
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

7) chain A
residue 157
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

8) chain A
residue 173
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

9) chain A
residue 182
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL A 302
source : AC2

10) chain A
residue 54
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL A 303
source : AC3

11) chain A
residue 55
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL A 303
source : AC3

12) chain A
residue 89
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 304
source : AC4

13) chain A
residue 90
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GOL A 304
source : AC4

14) chain A
residue 91
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL A 304
source : AC4

15) chain A
residue 99
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL A 304
source : AC4

16) chain A
residue 101
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL A 304
source : AC4

17) chain A
residue 190
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL A 304
source : AC4

18) chain A
residue 11
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_303

19) chain A
residue 54-55
type binding
ligand GOL: GLYCEROL
sequence TD
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_303

20) chain A
residue 109
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_303

21) chain A
residue 47
type binding
ligand GOL: GLYCEROL
sequence G
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_304

22) chain A
residue 89-91
type binding
ligand GOL: GLYCEROL
sequence EFS
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_304

23) chain A
residue 99-101
type binding
ligand GOL: GLYCEROL
sequence YID
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_304

24) chain A
residue 190
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_304

25) chain A
residue 89
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_301

26) chain A
residue 101
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_301

27) chain A
residue 103
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_301

28) chain A
residue 105
type binding
ligand GOL: GLYCEROL
sequence I
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_301

29) chain A
residue 181
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_301

30) chain A
residue 184
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_301

31) chain A
residue 104-106
type binding
ligand GOL: GLYCEROL
sequence NIK
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302

32) chain A
residue 147-149
type binding
ligand GOL: GLYCEROL
sequence DAC
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302

33) chain A
residue 157
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302

34) chain A
residue 167
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302

35) chain A
residue 169-170
type binding
ligand GOL: GLYCEROL
sequence YS
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302

36) chain A
residue 173
type binding
ligand GOL: GLYCEROL
sequence F
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302

37) chain A
residue 182-183
type binding
ligand GOL: GLYCEROL
sequence SY
description GLYCEROL binding site
source pdb_hetatom : GOL_3v8a_A_302


Display surface

Download
Links