eF-site ID 3v80-A PDB Code 3v80 Chain A click to enlarge Title Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with 5'-O-Propargylamino-5'-deoxyadenosine Classification TRANSFERASE Compound Probable inorganic polyphosphate/ATP-NAD kinase 1 Source null (PPNK1_LISMO) Sequence A:  MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVI SIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRP AEADKLVKLLAYQKVSYPLLKTTVKYGKEATYLALNESTV KSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKS LGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHV VSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFA RFRSFPFWRRVHDSFIED Description Functional site 1) chain A residue 49 type sequence L description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 2) chain A residue 122 type sequence N description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 3) chain A residue 123 type sequence E description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 4) chain A residue 149 type sequence G description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 5) chain A residue 150 type sequence D description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 6) chain A residue 162 type sequence A description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 7) chain A residue 163 type sequence Y description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 8) chain A residue 166 type sequence S description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 9) chain A residue 185 type sequence A description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 10) chain A residue 187 type sequence I description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 11) chain A residue 223 type sequence H description BINDING SITE FOR RESIDUE AOC A 301 source : AC1 12) chain A residue 45 type sequence D description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 13) chain A residue 72 type sequence L description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 14) chain A residue 74 type sequence F description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 15) chain A residue 75 type sequence Y description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 16) chain A residue 122 type sequence N description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 17) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 18) chain A residue 161 type sequence T description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 19) chain A residue 162 type sequence A description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 20) chain A residue 187 type sequence I description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 21) chain A residue 192 type sequence Y description BINDING SITE FOR RESIDUE AOC A 302 source : AC2 22) chain A residue 98 type sequence V description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 23) chain A residue 100 type sequence Y description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 24) chain A residue 173 type sequence H description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 25) chain A residue 247 type sequence R description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 26) chain A residue 251 type sequence F description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 27) chain A residue 252 type sequence P description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 28) chain A residue 253 type sequence F description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 29) chain A residue 256 type sequence R description BINDING SITE FOR RESIDUE CIT A 303 source : AC3 30) chain A residue 8 type sequence K description BINDING SITE FOR RESIDUE GOL A 304 source : AC4 31) chain A residue 44 type sequence G description BINDING SITE FOR RESIDUE GOL A 304 source : AC4 32) chain A residue 46 type sequence G description BINDING SITE FOR RESIDUE GOL A 304 source : AC4 33) chain A residue 47 type sequence T description BINDING SITE FOR RESIDUE GOL A 304 source : AC4 34) chain A residue 71 type sequence H description BINDING SITE FOR RESIDUE GOL A 304 source : AC4 35) chain A residue 45 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 46 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI2 37) chain A residue 122 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 158 type BINDING sequence S description BINDING => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI2 39) chain A residue 161 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 223 type BINDING sequence H description BINDING => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 45 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_00361, ECO:0000269|PubMed:17686780 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 148 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00361 source Swiss-Prot : SWS_FT_FI3 43) chain A residue 150 type BINDING sequence D description BINDING => ECO:0000305|PubMed:17686780 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links