eF-site ID 3v1f-A PDB Code 3v1f Chain A click to enlarge Title Crystal structure of de novo designed MID1-zinc H35E mutant Classification DE NOVO PROTEIN, METAL BINDING PROTEIN Compound Computational design, MID1-zinc H35E mutant Source (3V1F) Sequence A:  GSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLEQLMHE YFQQ Description Functional site 1) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE ZN A 704 source : AC1 2) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE ZN A 704 source : AC1 3) chain A residue 17 type sequence Q description BINDING SITE FOR RESIDUE EDO A 47 source : AC2 4) chain A residue 12 type sequence H description BINDING SITE FOR RESIDUE ZN B 703 source : AC3 5) chain A residue 16 type sequence H description BINDING SITE FOR RESIDUE ZN B 703 source : AC3 6) chain A residue 14 type sequence F description BINDING SITE FOR RESIDUE ACT B 47 source : AC4 7) chain A residue 30 type sequence L description BINDING SITE FOR RESIDUE ACT B 47 source : AC4 8) chain A residue 33 type sequence N description BINDING SITE FOR RESIDUE ACT B 47 source : AC4

Display surface Download Links