eF-site ID 3v1d-E PDB Code 3v1d Chain E click to enlarge Title Crystal structure of de novo designed MID1-cobalt Classification DE NOVO PROTEIN, METAL BINDING PROTEIN Compound Computational design, MID1-cobalt Source (3V1D) Sequence E:  GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLM HEYFQQSD Description Functional site 1) chain E residue 35 type sequence H description BINDING SITE FOR RESIDUE CO E 47 source : AC6 2) chain E residue 39 type sequence H description BINDING SITE FOR RESIDUE CO E 47 source : AC6 3) chain E residue 15 type sequence I description BINDING SITE FOR RESIDUE 1PE E 48 source : AC7 4) chain E residue 16 type sequence H description BINDING SITE FOR RESIDUE 1PE E 48 source : AC7 5) chain E residue 19 type sequence K description BINDING SITE FOR RESIDUE 1PE E 48 source : AC7 6) chain E residue 34 type sequence L description BINDING SITE FOR RESIDUE 1PE E 48 source : AC7 7) chain E residue 35 type sequence H description BINDING SITE FOR RESIDUE 1PE E 48 source : AC7 8) chain E residue 12 type sequence H description BINDING SITE FOR RESIDUE CO H 47 source : BC3 9) chain E residue 16 type sequence H description BINDING SITE FOR RESIDUE CO H 47 source : BC3

Display surface Download Links