eF-site ID 3v19-D PDB Code 3v19 Chain D click to enlarge Title Forestalling insulin fibrillation by insertion of a chiral clamp mechanism-based application of protein engineering to global health Classification HORMONE Compound Insulin Source null (INS_HUMAN) Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description Functional site 1) chain D residue 11 type sequence L description BINDING SITE FOR RESIDUE IPH C 200 source : AC3 2) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC4 3) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC4 4) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC4 5) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC5 6) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC5 7) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC5

Display surface Download Links