eF-site ID 3v19-ABCD PDB Code 3v19 Chain A, B, C, D click to enlarge Title Forestalling insulin fibrillation by insertion of a chiral clamp mechanism-based application of protein engineering to global health Classification HORMONE Compound Insulin Source Homo sapiens (Human) (INS_HUMAN) Sequence A:  GLLEQCCHSICSLYQLENYCN B:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT C:  GLLEQCCHSICSLYQLENYCN D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT Description Functional site 1) chain B residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 101 source : AC1 2) chain B residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 101 source : AC1 3) chain B residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN B 101 source : AC1 4) chain C residue 6 type sequence C description BINDING SITE FOR RESIDUE IPH C 200 source : AC3 5) chain C residue 9 type sequence S description BINDING SITE FOR RESIDUE IPH C 200 source : AC3 6) chain C residue 10 type sequence I description BINDING SITE FOR RESIDUE IPH C 200 source : AC3 7) chain C residue 11 type sequence C description BINDING SITE FOR RESIDUE IPH C 200 source : AC3 8) chain D residue 11 type sequence L description BINDING SITE FOR RESIDUE IPH C 200 source : AC3 9) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC4 10) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC4 11) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE ZN D 201 source : AC4 12) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC5 13) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC5 14) chain D residue 10 type sequence H description BINDING SITE FOR RESIDUE CL D 202 source : AC5 15) chain A residue 6-20 type prosite sequence CCHSICSLYQLENYC description INSULIN Insulin family signature. CCHSiCSlyqLenyC source prosite : PS00262

Display surface Download Links