eF-site ID 3uzc-A PDB Code 3uzc Chain A click to enlarge Title Thermostabilised Adenosine A2A receptor in complex with 4-(3-amino-5-phenyl-1,2,4-triazin-6-yl)-2-chlorophenol Classification SIGNALING PROTEIN Compound Adenosine A2A Receptor Source null (AA2AR_HUMAN) Sequence A:  SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVV SLAAADILVGVLAIPFAITISTGFCAACHGCLFIACFVLV LAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIA ICWVLSFAIGLTPMLGWNNCGQPGCGEGQVACLFEDVVPM NYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQ PLPGERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINC FTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIRE FRQTFRKIIRS Description Functional site 1) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 2) chain A residue 85 type sequence L description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 3) chain A residue 168 type sequence F description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 4) chain A residue 249 type sequence L description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 5) chain A residue 250 type sequence H description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 6) chain A residue 253 type sequence N description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 7) chain A residue 274 type sequence I description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 8) chain A residue 277 type sequence A description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 9) chain A residue 278 type sequence H description BINDING SITE FOR RESIDUE T4E A 330 source : AC1 10) chain A residue 67-77 type TOPO_DOM sequence STGFCAACHGC description Extracellular => ECO:0000269|PubMed:18832607 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 144-173 type TOPO_DOM sequence NNCGQPGCGEGQVACLFEDVVP description Extracellular => ECO:0000269|PubMed:18832607 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 259-266 type TOPO_DOM sequence CPDCSHAP description Extracellular => ECO:0000269|PubMed:18832607 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 33-42 type TOPO_DOM sequence LNSNLQNVTN description Cytoplasmic => ECO:0000269|PubMed:18832607 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 101-120 type TOPO_DOM sequence DRYIAIAIPLRYNGLVTGTR description Cytoplasmic => ECO:0000269|PubMed:18832607 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 199-234 type TOPO_DOM sequence RIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKS description Cytoplasmic => ECO:0000269|PubMed:18832607 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 253 type BINDING sequence N description BINDING => ECO:0000269|PubMed:21593763, ECO:0007744|PDB:2YDO source Swiss-Prot : SWS_FT_FI10 17) chain A residue 277 type BINDING sequence A description BINDING => ECO:0000269|PubMed:21593763, ECO:0007744|PDB:2YDO source Swiss-Prot : SWS_FT_FI10 18) chain A residue 278 type BINDING sequence H description BINDING => ECO:0000269|PubMed:21593763, ECO:0007744|PDB:2YDO source Swiss-Prot : SWS_FT_FI10 19) chain A residue 169 type BINDING sequence E description BINDING => ECO:0000269|PubMed:21593763, ECO:0007744|PDB:2YDO source Swiss-Prot : SWS_FT_FI10 20) chain A residue 90-106 type prosite sequence SSIFSLLAIAIDRYIAI description G_PROTEIN_RECEP_F1_1 G-protein coupled receptors family 1 signature. SSIfSLLAIAIDRYIaI source prosite : PS00237 21) chain A residue 235-258 type TRANSMEM sequence AAIIAGLFALCWLPLHIINCFTFF description Helical; Name=6 source Swiss-Prot : SWS_FT_FI8 22) chain A residue 267-290 type TRANSMEM sequence LWLMYLAIVLAHTNSVVNPFIYAY description Helical; Name=7 source Swiss-Prot : SWS_FT_FI9 23) chain A residue 8-32 type TRANSMEM sequence VYITVELAIAVLAILGNVLVCWAVW description Helical; Name=1 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 43-66 type TRANSMEM sequence YFVVSLAAADILVGVLAIPFAITI description Helical; Name=2 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 78-100 type TRANSMEM sequence LFIACFVLVLAQSSIFSLLAIAI description Helical; Name=3 source Swiss-Prot : SWS_FT_FI5 26) chain A residue 121-143 type TRANSMEM sequence AAGIIAICWVLSFAIGLTPMLGW description Helical; Name=4 source Swiss-Prot : SWS_FT_FI6 27) chain A residue 174-198 type TRANSMEM sequence MNYMVYFNFFACVLVPLLLMLGVYL description Helical; Name=5 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links