eF-site ID 3usf-B
PDB Code 3usf
Chain B

click to enlarge
Title Crystal structure of DAVA-4
Classification ISOMERASE
Compound Glutamate-1-semialdehyde 2,1-aminomutase
Source Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2) (GSA_SYNE7)
Sequence B:  FKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDR
VKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVA
MEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEA
CMAVLRIMRAYTGRDKIIKFEGCYHGHADTANTLTTPYND
LEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGL
REITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTL
GKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPL
AMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETG
HAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHR
GMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMS
AL
Description (1)  Glutamate-1-semialdehyde 2,1-aminomutase (E.C.5.4.3.8)


Functional site

1) chain B
residue 2305
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PLR A 5000
source : AC1

2) chain B
residue 2303
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HOZ A 1
source : AC2

3) chain B
residue 2304
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HOZ A 1
source : AC2

4) chain B
residue 2305
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HOZ A 1
source : AC2

5) chain B
residue 2122
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

6) chain B
residue 2123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

7) chain B
residue 2124
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

8) chain B
residue 2150
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

9) chain B
residue 2217
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

10) chain B
residue 2245
type
ligand
sequence D
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

11) chain B
residue 2248
type
ligand
sequence M
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

12) chain B
residue 2273
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

13) chain B
residue 2303-2305
type binding
ligand HOZ: (4S)-4,5-DIAMINOPENTANOIC ACID
sequence AGT
description (4S)-4,5-DIAMINOPENTANOIC ACID binding site
source pdb_hetatom : HOZ_3usf_A_1

14) chain B
residue 2125
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence E
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_A_5000

15) chain B
residue 2303-2305
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence AGT
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_A_5000

16) chain B
residue 2122-2124
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence SGT
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

17) chain B
residue 2127
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence C
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

18) chain B
residue 2150-2152
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence YHG
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

19) chain B
residue 2212
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence E
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

20) chain B
residue 2217
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence N
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

21) chain B
residue 2245
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence D
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

22) chain B
residue 2247-2248
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence VM
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000

23) chain B
residue 2273
type binding
ligand PLR: (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE
sequence K
description (5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGEN PHOSPHATE binding site
source pdb_hetatom : PLR_3usf_B_6000


Display surface

Download
Links