eF-site ID 3usf-B
PDB Code 3usf
Chain B

click to enlarge
Title Crystal structure of DAVA-4
Classification ISOMERASE
Compound Glutamate-1-semialdehyde 2,1-aminomutase
Source Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2) (GSA_SYNE7)
Sequence B:  FKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDR
VKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVA
MEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEA
CMAVLRIMRAYTGRDKIIKFEGCYHGHADTANTLTTPYND
LEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGL
REITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTL
GKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPL
AMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETG
HAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHR
GMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMS
AL
Description (1)  Glutamate-1-semialdehyde 2,1-aminomutase (E.C.5.4.3.8)


Functional site

1) chain B
residue 2305
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PLR A 5000
source : AC1

2) chain B
residue 2303
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HOZ A 1
source : AC2

3) chain B
residue 2304
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HOZ A 1
source : AC2

4) chain B
residue 2305
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HOZ A 1
source : AC2

5) chain B
residue 2122
type
ligand
sequence S
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

6) chain B
residue 2123
type
ligand
sequence G
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

7) chain B
residue 2124
type
ligand
sequence T
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

8) chain B
residue 2150
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

9) chain B
residue 2217
type
ligand
sequence N
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

10) chain B
residue 2245
type
ligand
sequence D
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

11) chain B
residue 2248
type
ligand
sequence M
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

12) chain B
residue 2273
type
ligand
sequence K
description BINDING SITE FOR RESIDUE PLR B 6000
source : AC3

13) chain B
residue 2242-2278
type prosite
ligand
sequence LVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGG
description Aminotransferases class-III pyridoxal-phosphate attachment site.[LIVMFYWCS]-[LIVMFYWCAH]-x-D-[ED]-[IVA]-x(2,3)-[GAT]-[LIVMFAGCYN]-x(0,1)-[RSACLIH]-x-[GSADEHRM]-x(10,16)-[DH]-[LIVMFCAG]-[LIVMFYSTAR]-x(2)-[GSA]-K-x(2,3)-[GSTADNV]-[GSAC].
source prosite : PS00600


Display surface

Download
Links