eF-site ID 3ur4-A PDB Code 3ur4 Chain A click to enlarge Title Crystal structure of human WD repeat domain 5 with compound Classification TRANSCRIPTION/INHIBITOR Compound WD repeat-containing protein 5 Source Homo sapiens (Human) (WDR5_HUMAN) Sequence A:  VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKT LKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS YDGLCRIWDTASGQCLKTLIDDNPPVSFVKFSPNGKYILA ATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGG KWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHP TENIIASAALENDKTIKLWKSDC Description Functional site 1) chain A residue 49 type sequence S description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 2) chain A residue 50 type sequence S description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 3) chain A residue 65 type sequence A description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 4) chain A residue 89 type sequence G description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 5) chain A residue 90 type sequence I description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 6) chain A residue 91 type sequence S description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 7) chain A residue 133 type sequence F description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 8) chain A residue 175 type sequence S description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 9) chain A residue 191 type sequence Y description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 10) chain A residue 261 type sequence C description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 11) chain A residue 305 type sequence I description BINDING SITE FOR RESIDUE 0BW A 1000 source : AC1 12) chain A residue 228 type sequence Y description BINDING SITE FOR RESIDUE EDO A 2000 source : AC2 13) chain A residue 250 type sequence K description BINDING SITE FOR RESIDUE EDO A 2000 source : AC2 14) chain A residue 289 type sequence Q description BINDING SITE FOR RESIDUE EDO A 2000 source : AC2 15) chain A residue 191 type sequence Y description BINDING SITE FOR RESIDUE EDO A 2006 source : AC3 16) chain A residue 223 type sequence S description BINDING SITE FOR RESIDUE CL A 1001 source : AC4 17) chain A residue 224 type sequence P description BINDING SITE FOR RESIDUE CL A 1001 source : AC4 18) chain A residue 225 type sequence N description BINDING SITE FOR RESIDUE CL A 1001 source : AC4 19) chain A residue 221 type sequence K description BINDING SITE FOR RESIDUE CL A 1002 source : AC5 20) chain A residue 265 type sequence N description BINDING SITE FOR RESIDUE CL A 1002 source : AC5 21) chain A residue 309 type sequence C description BINDING SITE FOR RESIDUE CL A 1002 source : AC5 22) chain A residue 184 type sequence S description BINDING SITE FOR RESIDUE CL A 1003 source : AC6 23) chain A residue 199 type sequence D description BINDING SITE FOR RESIDUE CL A 1003 source : AC6 24) chain A residue 200 type sequence T description BINDING SITE FOR RESIDUE CL A 1003 source : AC6 25) chain A residue 201 type sequence A description BINDING SITE FOR RESIDUE CL A 1003 source : AC6 26) chain A residue 180 type sequence N description BINDING SITE FOR RESIDUE CL A 1005 source : AC7 27) chain A residue 226 type sequence G description BINDING SITE FOR RESIDUE CL A 1005 source : AC7 28) chain A residue 52 type sequence K description BINDING SITE FOR RESIDUE SO4 A 3000 source : AC8 29) chain A residue 136 type sequence N description BINDING SITE FOR RESIDUE SO4 A 3000 source : AC8 30) chain A residue 221 type sequence K description BINDING SITE FOR RESIDUE SO4 A 3000 source : AC8 31) chain A residue 263 type sequence F description BINDING SITE FOR RESIDUE SO4 A 3000 source : AC8 32) chain A residue 181 type sequence R description BINDING SITE FOR RESIDUE SO4 A 3002 source : AC9 33) chain A residue 227 type sequence K description BINDING SITE FOR RESIDUE SO4 A 3002 source : AC9 34) chain A residue 102-116 type prosite sequence LVSASDDKTLKIWDV description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 35) chain A residue 144-158 type prosite sequence IVSGSFDESVRIWDV description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 36) chain A residue 186-200 type prosite sequence IVSSSYDGLCRIWDT description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 37) chain A residue 274-288 type prosite sequence IVSGSEDNLVYIWNL description WD_REPEATS_1 Trp-Asp (WD) repeats signature. LVSAsdDkTLKIWDV source prosite : PS00678 38) chain A residue 107 type SITE sequence D description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 39) chain A residue 133 type SITE sequence F description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 263 type SITE sequence F description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 41) chain A residue 322 type SITE sequence E description Important for interaction with histone H3 source Swiss-Prot : SWS_FT_FI1 42) chain A residue 112 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 46 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links