eF-site ID 3umo-A PDB Code 3umo Chain A click to enlarge Title Crystal structure of the Phosphofructokinase-2 from Escherichia coli in complex with Potassium Classification TRANSFERASE Compound 6-phosphofructokinase isozyme 2 Source Escherichia coli (strain K12) (K6PF2_ECOLI) Sequence A:  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGG GINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPV ATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQG IRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELT QPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGV AAGSAATLNQGTRLCSHDDTQKIYAYLSR Description Functional site 1) chain A residue 185 type sequence K description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 2) chain A residue 187 type sequence N description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 3) chain A residue 224 type sequence S description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 4) chain A residue 225 type sequence L description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 5) chain A residue 226 type sequence G description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 6) chain A residue 227 type sequence P description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 7) chain A residue 229 type sequence G description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 8) chain A residue 251 type sequence T description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 9) chain A residue 254 type sequence A description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 10) chain A residue 255 type sequence G description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 11) chain A residue 258 type sequence M description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 12) chain A residue 280 type sequence V description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 13) chain A residue 283 type sequence G description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 14) chain A residue 284 type sequence S description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 15) chain A residue 287 type sequence T description BINDING SITE FOR RESIDUE ATP A 313 source : AC3 16) chain A residue 250 type sequence S description BINDING SITE FOR RESIDUE K A 314 source : AC4 17) chain A residue 252 type sequence V description BINDING SITE FOR RESIDUE K A 314 source : AC4 18) chain A residue 286 type sequence A description BINDING SITE FOR RESIDUE K A 314 source : AC4 19) chain A residue 289 type sequence N description BINDING SITE FOR RESIDUE K A 314 source : AC4 20) chain A residue 291 type sequence G description BINDING SITE FOR RESIDUE K A 314 source : AC4 21) chain A residue 293 type sequence R description BINDING SITE FOR RESIDUE K A 314 source : AC4 22) chain A residue 23 type sequence Y description BINDING SITE FOR RESIDUE ATP A 315 source : AC6 23) chain A residue 24 type sequence P description BINDING SITE FOR RESIDUE ATP A 315 source : AC6 24) chain A residue 26 type sequence G description BINDING SITE FOR RESIDUE ATP A 315 source : AC6 25) chain A residue 27 type sequence K description BINDING SITE FOR RESIDUE ATP A 315 source : AC6 26) chain A residue 102 type sequence E description BINDING SITE FOR RESIDUE ATP A 315 source : AC6 27) chain A residue 187 type sequence N description BINDING SITE FOR RESIDUE ATP B 312 source : AC7 28) chain A residue 189 type sequence K description BINDING SITE FOR RESIDUE ATP B 312 source : AC7 29) chain A residue 226 type sequence G description BINDING SITE FOR RESIDUE ATP B 312 source : AC7 30) chain A residue 251 type sequence T description BINDING SITE FOR RESIDUE ATP B 312 source : AC7 31) chain A residue 27 type sequence K description BINDING SITE FOR RESIDUE ATP B 313 source : AC9 32) chain A residue 256 type ACT_SITE sequence D description ACT_SITE => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 33) chain A residue 12 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 34) chain A residue 39 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 35) chain A residue 90 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 36) chain A residue 139 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 37) chain A residue 256 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 38) chain A residue 27 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18762190, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI3 39) chain A residue 190 type BINDING sequence E description BINDING => ECO:0000305 source Swiss-Prot : SWS_FT_FI6 40) chain A residue 38-62 type prosite sequence GGGGINVARAIAHLGGSATAIFPAG description PFKB_KINASES_1 pfkB family of carbohydrate kinases signature 1. GGgGiNVAraIaHLGgsataifpaG source prosite : PS00583 41) chain A residue 250-263 type prosite sequence STVGAGDSMVGAMT description PFKB_KINASES_2 pfkB family of carbohydrate kinases signature 2. STvGAGDsmvGAMT source prosite : PS00584 42) chain A residue 185 type BINDING sequence K description in other chain => ECO:0000269|PubMed:18762190, ECO:0000269|PubMed:23823238, ECO:0000269|Ref.10, ECO:0000269|Ref.11, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI4 43) chain A residue 224 type BINDING sequence S description in other chain => ECO:0000269|PubMed:18762190, ECO:0000269|PubMed:23823238, ECO:0000269|Ref.10, ECO:0000269|Ref.11, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI4 44) chain A residue 248 type BINDING sequence S description in other chain => ECO:0000269|PubMed:18762190, ECO:0000269|PubMed:23823238, ECO:0000269|Ref.10, ECO:0000269|Ref.11, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI4 45) chain A residue 280 type BINDING sequence V description in other chain => ECO:0000269|PubMed:18762190, ECO:0000269|PubMed:23823238, ECO:0000269|Ref.10, ECO:0000269|Ref.11, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI4 46) chain A residue 284 type BINDING sequence S description in other chain => ECO:0000269|PubMed:18762190, ECO:0000269|PubMed:23823238, ECO:0000269|Ref.10, ECO:0000269|Ref.11, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI4 47) chain A residue 187 type BINDING sequence N description in other chain => ECO:0000269|PubMed:18762190, ECO:0007744|PDB:3CQD source Swiss-Prot : SWS_FT_FI5 48) chain A residue 250 type BINDING sequence S description BINDING => ECO:0000269|PubMed:23823238 source Swiss-Prot : SWS_FT_FI7 49) chain A residue 252 type BINDING sequence V description BINDING => ECO:0000269|PubMed:23823238 source Swiss-Prot : SWS_FT_FI7 50) chain A residue 286 type BINDING sequence A description BINDING => ECO:0000269|PubMed:23823238 source Swiss-Prot : SWS_FT_FI7 51) chain A residue 289 type BINDING sequence N description BINDING => ECO:0000269|PubMed:23823238 source Swiss-Prot : SWS_FT_FI7 52) chain A residue 291 type BINDING sequence G description BINDING => ECO:0000269|PubMed:23823238 source Swiss-Prot : SWS_FT_FI7 53) chain A residue 293 type BINDING sequence R description BINDING => ECO:0000269|PubMed:23823238 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links