eF-site ID 3ufe-A PDB Code 3ufe Chain A click to enlarge Title Structure of transcriptional antiterminator (BGLG-family) at 1.5 A resolution Classification TRANSCRIPTION Compound Transcriptional antiterminator (BGLG family) Source Bacillus subtilis (GLCT_BACSU) Sequence A:  LRPLSEVNQHSQLMAQLVEVIEDSFQMKVNKESVNYLRLI RHIRFTIERIKKEEPTKEPEKLMLLLKNEYPLCYNTAWKL IKILQQTLKKPVHEAEAVYLTLHLIPINQ Description Functional site 1) chain A residue 96 type sequence E description BINDING SITE FOR RESIDUE CL A 112 source : AC1 2) chain A residue 72 type sequence Y description BINDING SITE FOR RESIDUE CL A 113 source : AC2 3) chain A residue 74 type sequence L description BINDING SITE FOR RESIDUE CL A 113 source : AC2 4) chain A residue 75 type sequence C description BINDING SITE FOR RESIDUE CL A 113 source : AC2 5) chain A residue 32 type sequence N description BINDING SITE FOR RESIDUE PO4 A 114 source : AC3 6) chain A residue 35 type sequence S description BINDING SITE FOR RESIDUE PO4 A 114 source : AC3 7) chain A residue 37 type sequence N description BINDING SITE FOR RESIDUE PO4 A 114 source : AC3 8) chain A residue 110 type sequence N description BINDING SITE FOR RESIDUE GOL A 115 source : AC4 9) chain A residue 34 type sequence E description BINDING SITE FOR RESIDUE PO4 B 112 source : AC5 10) chain A residue 105 type sequence H description BINDING SITE FOR RESIDUE PO4 B 112 source : AC5 11) chain A residue 88 type sequence Q description BINDING SITE FOR RESIDUE GOL B 113 source : AC6 12) chain A residue 44 type MOD_RES sequence H description Phosphohistidine; by HPr => ECO:0000305|PubMed:14527945 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links