eF-site ID 3u9q-AB PDB Code 3u9q Chain A, B click to enlarge Title Ligand binding domain of PPARgamma complexed with Decanoic Acid and PGC-1a peptide Classification TRANSCRIPTION Compound Peroxisome proliferator-activated receptor gamma Source Homo sapiens (Human) (PRGC1_HUMAN) Sequence A:  SADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPF VIYDMNSLMMGEDKIKEVAIRIFQGCQFRSVEAVQEITEY AKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGV LISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALEL DDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALEL QLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKT ETDMSLHPLLQEIYKDL B:  SLLKKLLLA Description Functional site 1) chain A residue 278 type sequence A description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 2) chain A residue 282 type sequence F description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 3) chain A residue 285 type sequence C description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 4) chain A residue 289 type sequence S description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 5) chain A residue 323 type sequence H description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 6) chain A residue 360 type sequence F description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 7) chain A residue 363 type sequence F description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 8) chain A residue 449 type sequence H description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 9) chain A residue 469 type sequence L description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 10) chain A residue 473 type sequence Y description BINDING SITE FOR RESIDUE DKA A 1 source : AC1 11) chain B residue 146 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 323 type MOD_RES sequence H description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 449 type MOD_RES sequence H description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 473 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000250|UniProtKB:O70343 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 224 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:36737649 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links