eF-site ID 3tz7-A PDB Code 3tz7 Chain A click to enlarge Title Kinase domain of cSrc in complex with RL103 Classification TRANSFERASE/TRANSFERASE INHIBITOR Compound Proto-oncogene tyrosine-protein kinase Src Source Gallus gallus (Chicken) (SRC_CHICK) Sequence A:  KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKT LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYI VTEYMSKGCLLDFLKGEMGKYLRLPQLVDMAAQIASGMAY VERMNYVHRDLRAANILVGENLVCKVADFGFPIKWTAPEA ALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLD QVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQ AFLEDYFTSTEPQYQPGENL Description Functional site 1) chain A residue 273 type sequence L description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 2) chain A residue 293 type sequence A description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 3) chain A residue 310 type sequence E description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 4) chain A residue 313 type sequence V description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 5) chain A residue 314 type sequence M description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 6) chain A residue 317 type sequence L description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 7) chain A residue 322 type sequence L description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 8) chain A residue 323 type sequence V description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 9) chain A residue 339 type sequence E description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 10) chain A residue 341 type sequence M description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 11) chain A residue 348 type sequence D description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 12) chain A residue 403 type sequence A description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 13) chain A residue 404 type sequence D description BINDING SITE FOR RESIDUE AQB A 601 source : AC1 14) chain A residue 527 type MOD_RES sequence Y description Phosphotyrosine; by CSK => ECO:0000269|PubMed:2420005 source Swiss-Prot : SWS_FT_FI7 15) chain A residue 386 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 273 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 436 type MOD_RES sequence Y description Phosphotyrosine; by autocatalysis => ECO:0000269|PubMed:8856081 source Swiss-Prot : SWS_FT_FI5 18) chain A residue 498 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000269|PubMed:19948721 source Swiss-Prot : SWS_FT_FI6 19) chain A residue 273-295 type prosite sequence LGQGCFGEVWMGTWNGTTRVAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGQGCFGEVWmGtwngttr...........VAIK source prosite : PS00107 20) chain A residue 382-394 type prosite sequence YVHRDLRAANILV description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. YVHrDLRAANILV source prosite : PS00109 21) chain A residue 295 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links