eF-site ID 3tm4-A
PDB Code 3tm4
Chain A

click to enlarge
Title Crystal structure of Trm14 from Pyrococcus furiosus in complex with S-adenosylmethionine
Classification TRANSFERASE
Compound tRNA (guanine N2-)-methyltransferase Trm14
Source Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (Q8U248_PYRFU)
Sequence A:  MKFLLTTAQGIEDIAKREVSLLLKKLGISFQIEEKPLGIE
GRLLLEAEKAYYVDEKGRKRELSISTYLNENSRLLHRVII
EIASEKFNGIEKDESEEALKRIKDFVSSLPVEQFVKVSET
FAVRSFRKGDHNITSIDIARTVGEAIFERLSRFGTPLVNL
DHPAVIFRAELIKDVFFLGIDTTGDSSLHKRPWRVYDHPA
HLKASIANAMIELAELDGGSVLDPMCGSGTILIELALRRY
SGEIIGIEKYRKHLIGAEMNALAAGVLDKIKFIQGDATQL
SQYVDSVDFAISNLPYGSMIPDLYMKFFNELAKVLEKRGV
FITTEKKAIEEAIAENGFEIIHHRVIGHGGLMVHLYVVKL
EHHH
Description (1)  tRNA (guanine N2-)-methyltransferase Trm14 (E.C.2.1.1.-)


Functional site

1) chain A
residue 198
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

2) chain A
residue 200
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

3) chain A
residue 201
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

4) chain A
residue 202
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

5) chain A
residue 224
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

6) chain A
residue 225
type
ligand
sequence M
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

7) chain A
residue 226
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

8) chain A
residue 227
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

9) chain A
residue 228
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

10) chain A
residue 230
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

11) chain A
residue 248
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

12) chain A
residue 249
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

13) chain A
residue 250
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

14) chain A
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

15) chain A
residue 275
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

16) chain A
residue 276
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

17) chain A
residue 277
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

18) chain A
residue 293
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

19) chain A
residue 309
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SAM A 401
source : AC1

20) chain A
residue 194
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence R
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

21) chain A
residue 198
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence H
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

22) chain A
residue 200-202
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence AHL
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

23) chain A
residue 223-231
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence DPMCGSGTI
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

24) chain A
residue 247-250
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence IEKY
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

25) chain A
residue 253
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence H
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

26) chain A
residue 275-278
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence GDAT
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

27) chain A
residue 293-296
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence NLPY
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401

28) chain A
residue 309
type binding
ligand SAM: S-ADENOSYLMETHIONINE
sequence L
description S-ADENOSYLMETHIONINE binding site
source pdb_hetatom : SAM_3tm4_A_401


Display surface

Download
Links