eF-site ID 3t30-FGHIJ PDB Code 3t30 Chain F, G, H, I, J click to enlarge Title Human nucleoplasmin (Npm2): a histone chaperone in oocytes and early embryos Classification CHAPERONE Compound Nucleoplasmin-2 Source (NPM2_HUMAN) Sequence F:  TVLWGCELSQERRTWTFRPQCRLLLHTICLGEKAKEEMHR VEILPPQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAG SGPVFLSGQER G:  TTVLWGCELSQERRTWTFRPQCRLLLHTICLGEKAKEEMH RVEILPPAMQPVTIASLQASVLPMVSMVGVQLSPPVTFQL RAGSGPVFLSGQER H:  TTVLWGCELSQERRTWTFRPSCRLLLHTICLGEKAKEEMH RVEILPPQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRA GSGPVFLSGQERY I:  TTVLWGCELSQERRTWTFRPSCRLLLHTICLGEKAKEEMH RVEILPPPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAG SGPVFLSGQERY J:  TTVLWGCELSQERRTWTFCRLLLHTICLGEKAKEEMHRVE ILPPAQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGS GPVFLSGQER Description Functional site 1) chain H residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 2) chain H residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 3) chain I residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 4) chain I residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 5) chain J residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 6) chain J residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 7) chain F residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 8) chain F residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 9) chain G residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 10) chain G residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1

Display surface Download Links