eF-site ID 3t30-ABCDE PDB Code 3t30 Chain A, B, C, D, E click to enlarge Title Human nucleoplasmin (Npm2): a histone chaperone in oocytes and early embryos Classification CHAPERONE Compound Nucleoplasmin-2 Source (NPM2_HUMAN) Sequence A:  TVLWGCELSQERRTWTFRPCRLLLHTICLGEKAKEEMHRV EILPPANMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLR AGSGPVFLSGQER B:  TTVLWGCELSQERRTWTFRSCRLLLHTICLGEKAKEEMHR VEILPPQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAG SGPVFLSGQERY C:  TTVLWGCELSQERRTWTFRPQSCRLLLHTICLGEKAKEEM HRVEILPPMQPVTIASLQASVLPMVSMVGVQLSPPVTFQL RAGSGPVFLSGQERY D:  TTVLWGCELSQERRTWTFRPCRLLLHTICLGEKAKEEMHR VEILPPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSG PVFLSGQERY E:  VLWGCELSQERRTWTFRPQSCRLLLHTICLGEKAKEEMHR VEILPPAQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRA GSGPVFLSGQER Description Functional site 1) chain B residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 2) chain C residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 3) chain B residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 4) chain E residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 5) chain E residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 6) chain D residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 7) chain D residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 8) chain A residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 9) chain A residue 84 type SITE sequence Q description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1 10) chain C residue 57 type SITE sequence E description Interaction between pentamers source Swiss-Prot : SWS_FT_FI1

Display surface Download Links