eF-site ID 3syy-A PDB Code 3syy Chain A click to enlarge Title Crystal Structure of an alkaline exonuclease (LHK-Exo) from Laribacter hongkongensis Classification HYDROLASE Compound Exonuclease Source Laribacter hongkongensis (strain HLHK9) (C1D7P6_LARHH) Sequence A:  TEEWFAARLGKVTASRVADVMTKAASRQNYMAELICQRLT GTQEINAAMQRGTELEPHARARYIIETGEIVTEVGLIDHP TIAGFGASPDGLVGDTGLIEIKCPNTWTHIETIKTGKPKP EYIKQMQTQMACTGRQWCDFVSYDDRLPDDMQYFCTRIER DDALIAEIETEVSAFLAELEAEIEYLKRKAAKLA Description Functional site 1) chain A residue 102 type sequence D description BINDING SITE FOR RESIDUE MG A 400 source : AC1 2) chain A residue 112 type sequence E description BINDING SITE FOR RESIDUE MG A 400 source : AC1 3) chain A residue 113 type sequence I description BINDING SITE FOR RESIDUE MG A 400 source : AC1 4) chain A residue 100 type sequence S description BINDING SITE FOR RESIDUE MG A 401 source : AC2 5) chain A residue 102 type sequence D description BINDING SITE FOR RESIDUE MG A 401 source : AC2 6) chain A residue 112 type sequence E description BINDING SITE FOR RESIDUE MG A 401 source : AC2 7) chain A residue 137 type sequence Q description BINDING SITE FOR RESIDUE MG A 401 source : AC2

Display surface Download Links