eF-site ID 3swc-ABPQ PDB Code 3swc Chain A, B, P, Q click to enlarge Title GLP (G9a-like protein) SET domain in complex with Dnmt3aK44me2 peptide Classification TRANSFERASE Compound Histone-lysine N-methyltransferase EHMT1 Source Homo sapiens (Human) (DNM3A_MOUSE) Sequence A:  VERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNC VTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYD KDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLR ARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEA DVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEP NLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGER FWDIKGKLFSCRCGSPKCRHS B:  VERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNC VTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYD KDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLR ARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEA DVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEP NLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGER FWDIKGKLFSCRCGSPKCRHS P:  TARXVGRPG Q:  ARXVGRPG Description Functional site 1) chain A residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 2) chain A residue 1044 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 3) chain A residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 4) chain A residue 1078 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 5) chain A residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 6) chain A residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 7) chain A residue 1080 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 8) chain A residue 1084 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 9) chain A residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 10) chain A residue 1033 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 11) chain A residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 12) chain A residue 1042 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 13) chain A residue 1172 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 14) chain A residue 1225 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 15) chain A residue 1227 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 16) chain A residue 1232 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 17) chain A residue 1105 type sequence M description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 18) chain A residue 1107 type sequence W description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 19) chain A residue 1141 type sequence S description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 20) chain A residue 1142 type sequence Y description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 21) chain A residue 1166 type sequence R description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 22) chain A residue 1169 type sequence N description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 23) chain A residue 1170 type sequence H description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 24) chain A residue 1211 type sequence Y description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 25) chain A residue 1223 type sequence F description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 26) chain A residue 1224 type sequence S description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 27) chain A residue 1225 type sequence C description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 28) chain A residue 1226 type sequence R description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 29) chain P residue 47 type sequence R description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 30) chain B residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN B 305 source : AC6 31) chain B residue 1044 type sequence C description BINDING SITE FOR RESIDUE ZN B 305 source : AC6 32) chain B residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN B 305 source : AC6 33) chain B residue 1078 type sequence C description BINDING SITE FOR RESIDUE ZN B 305 source : AC6 34) chain B residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN B 306 source : AC7 35) chain B residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN B 306 source : AC7 36) chain B residue 1080 type sequence C description BINDING SITE FOR RESIDUE ZN B 306 source : AC7 37) chain B residue 1084 type sequence C description BINDING SITE FOR RESIDUE ZN B 306 source : AC7 38) chain B residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN B 307 source : AC8 39) chain B residue 1033 type sequence C description BINDING SITE FOR RESIDUE ZN B 307 source : AC8 40) chain B residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN B 307 source : AC8 41) chain B residue 1042 type sequence C description BINDING SITE FOR RESIDUE ZN B 307 source : AC8 42) chain B residue 1172 type sequence C description BINDING SITE FOR RESIDUE ZN B 308 source : AC9 43) chain B residue 1225 type sequence C description BINDING SITE FOR RESIDUE ZN B 308 source : AC9 44) chain B residue 1227 type sequence C description BINDING SITE FOR RESIDUE ZN B 308 source : AC9 45) chain B residue 1232 type sequence C description BINDING SITE FOR RESIDUE ZN B 308 source : AC9 46) chain B residue 1105 type sequence M description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 47) chain B residue 1106 type sequence G description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 48) chain B residue 1107 type sequence W description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 49) chain B residue 1141 type sequence S description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 50) chain B residue 1142 type sequence Y description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 51) chain B residue 1166 type sequence R description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 52) chain B residue 1167 type sequence F description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 53) chain B residue 1169 type sequence N description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 54) chain B residue 1170 type sequence H description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 55) chain B residue 1211 type sequence Y description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 56) chain B residue 1215 type sequence F description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 57) chain B residue 1223 type sequence F description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 58) chain B residue 1225 type sequence C description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 59) chain B residue 1226 type sequence R description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 60) chain Q residue 47 type sequence R description BINDING SITE FOR RESIDUE SAH B 201 source : BC1 61) chain A residue 1031 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 62) chain A residue 1105 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 63) chain A residue 1142 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 64) chain A residue 1169 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 65) chain A residue 1172 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 66) chain A residue 1225 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 67) chain A residue 1226 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 68) chain A residue 1227 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 69) chain A residue 1232 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 70) chain B residue 1031 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 71) chain B residue 1033 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 72) chain A residue 1033 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 73) chain B residue 1037 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 74) chain B residue 1042 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 75) chain B residue 1044 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 76) chain B residue 1074 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 77) chain B residue 1078 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 78) chain B residue 1080 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 79) chain B residue 1084 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 80) chain B residue 1105 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 81) chain B residue 1142 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 82) chain B residue 1169 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 83) chain A residue 1037 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 84) chain B residue 1172 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 85) chain B residue 1225 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 86) chain B residue 1226 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 87) chain B residue 1227 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 88) chain B residue 1232 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 89) chain A residue 1042 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 90) chain A residue 1044 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 91) chain A residue 1074 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 92) chain A residue 1078 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 93) chain A residue 1080 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 94) chain A residue 1084 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 95) chain A residue 1124 type SITE sequence Y description Histone H3K9me binding => ECO:0000269|PubMed:18264113, ECO:0000269|PubMed:20084102 source Swiss-Prot : SWS_FT_FI2 96) chain B residue 1124 type SITE sequence Y description Histone H3K9me binding => ECO:0000269|PubMed:18264113, ECO:0000269|PubMed:20084102 source Swiss-Prot : SWS_FT_FI2 97) chain A residue 1017 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 98) chain B residue 1017 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links