eF-site ID 3swc-A PDB Code 3swc Chain A click to enlarge Title GLP (G9a-like protein) SET domain in complex with Dnmt3aK44me2 peptide Classification TRANSFERASE Compound Histone-lysine N-methyltransferase EHMT1 Source Homo sapiens (Human) (DNM3A_MOUSE) Sequence A:  VERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNC VTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYD KDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLR ARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEA DVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEP NLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGER FWDIKGKLFSCRCGSPKCRHS Description Functional site 1) chain A residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 2) chain A residue 1044 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 3) chain A residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 4) chain A residue 1078 type sequence C description BINDING SITE FOR RESIDUE ZN A 301 source : AC1 5) chain A residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 6) chain A residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 7) chain A residue 1080 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 8) chain A residue 1084 type sequence C description BINDING SITE FOR RESIDUE ZN A 302 source : AC2 9) chain A residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 10) chain A residue 1033 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 11) chain A residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 12) chain A residue 1042 type sequence C description BINDING SITE FOR RESIDUE ZN A 303 source : AC3 13) chain A residue 1172 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 14) chain A residue 1225 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 15) chain A residue 1227 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 16) chain A residue 1232 type sequence C description BINDING SITE FOR RESIDUE ZN A 304 source : AC4 17) chain A residue 1105 type sequence M description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 18) chain A residue 1107 type sequence W description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 19) chain A residue 1141 type sequence S description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 20) chain A residue 1142 type sequence Y description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 21) chain A residue 1166 type sequence R description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 22) chain A residue 1169 type sequence N description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 23) chain A residue 1170 type sequence H description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 24) chain A residue 1211 type sequence Y description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 25) chain A residue 1223 type sequence F description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 26) chain A residue 1224 type sequence S description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 27) chain A residue 1225 type sequence C description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 28) chain A residue 1226 type sequence R description BINDING SITE FOR RESIDUE SAH A 202 source : AC5 29) chain A residue 1031 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 30) chain A residue 1105 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 31) chain A residue 1142 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI1 32) chain A residue 1169 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 33) chain A residue 1172 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 34) chain A residue 1225 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 35) chain A residue 1226 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 36) chain A residue 1227 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 37) chain A residue 1232 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 38) chain A residue 1033 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 39) chain A residue 1037 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 40) chain A residue 1042 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 41) chain A residue 1044 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 42) chain A residue 1074 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 43) chain A residue 1078 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 44) chain A residue 1080 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 45) chain A residue 1084 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 46) chain A residue 1124 type SITE sequence Y description Histone H3K9me binding => ECO:0000269|PubMed:18264113, ECO:0000269|PubMed:20084102 source Swiss-Prot : SWS_FT_FI2 47) chain A residue 1017 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links