eF-site ID 3sp5-AP PDB Code 3sp5 Chain A, P click to enlarge Title Crystal structure of human 14-3-3 sigma C38V/N166H in complex with TASK-3 peptide and stabilizer Cotylenol Classification PEPTIDE BINDING PROTEIN Compound 14-3-3 protein sigma Source null (3SP5) Sequence A:  AMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEEL SVEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEE KGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAES RVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD ISKKEMPPTHPIRLGLALNFSVFHYEIANSPEEAISLAKT TFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT P:  KRRKXV Description Functional site 1) chain A residue 42 type sequence N description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 2) chain A residue 119 type sequence F description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 3) chain A residue 122 type sequence K description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 4) chain A residue 123 type sequence M description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 5) chain A residue 167 type sequence P description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 6) chain A residue 168 type sequence I description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 7) chain P residue 374 type sequence V description BINDING SITE FOR RESIDUE CX7 A 232 source : AC1 8) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE MG A 233 source : AC2 9) chain A residue 110 type sequence E description BINDING SITE FOR RESIDUE MG A 233 source : AC2 10) chain A residue 188 type sequence E description BINDING SITE FOR RESIDUE MG A 233 source : AC2 11) chain A residue 75 type sequence E description BINDING SITE FOR RESIDUE MG A 234 source : AC3 12) chain A residue 161 type sequence E description BINDING SITE FOR RESIDUE MG A 234 source : AC3 13) chain A residue 74 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 5 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI2 15) chain A residue 41-51 type prosite sequence RNLLSVAYKNV description 1433_1 14-3-3 proteins signature 1. RNLLSVAYKNV source prosite : PS00796 16) chain A residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein source Swiss-Prot : SWS_FT_FI1 17) chain A residue 129 type SITE sequence R description Interaction with phosphoserine on interacting protein source Swiss-Prot : SWS_FT_FI1

Display surface Download Links