eF-site ID 3sec-A PDB Code 3sec Chain A click to enlarge Title Crystal structure of Methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate Classification LYASE/LYASE INHIBITOR Compound Orotidine 5'-phosphate decarboxylase Source Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum) (PYRF_METTH) Sequence A:  VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLS EGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKA GADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPG AEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREI IGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADN PAAAAAGIIESIKD Description Functional site 1) chain A residue 33 type sequence E description BINDING SITE FOR RESIDUE GOL A 1000 source : AC1 2) chain A residue 159 type sequence T description BINDING SITE FOR RESIDUE GOL A 1000 source : AC1 3) chain A residue 161 type sequence P description BINDING SITE FOR RESIDUE GOL A 1000 source : AC1 4) chain A residue 210 type sequence N description BINDING SITE FOR RESIDUE GOL A 1000 source : AC1 5) chain A residue 212 type sequence A description BINDING SITE FOR RESIDUE GOL A 1000 source : AC1 6) chain A residue 20 type sequence D description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 7) chain A residue 42 type sequence K description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 8) chain A residue 70 type sequence D description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 9) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 10) chain A residue 75 type sequence D description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 11) chain A residue 76 type sequence I description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 12) chain A residue 79 type sequence T description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 13) chain A residue 123 type sequence L description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 14) chain A residue 126 type sequence M description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 15) chain A residue 127 type sequence S description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 16) chain A residue 180 type sequence P description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 17) chain A residue 185 type sequence Q description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 18) chain A residue 202 type sequence G description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 19) chain A residue 203 type sequence R description BINDING SITE FOR RESIDUE PFU A 2000 source : AC2 20) chain A residue 72 type ACT_SITE sequence K description Proton donor source Swiss-Prot : SWS_FT_FI1 21) chain A residue 20 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 42 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 70 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 24) chain A residue 127 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 25) chain A residue 180 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 26) chain A residue 202 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 27) chain A residue 203 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 67-80 type prosite sequence IIADFKVADIPETN description OMPDECASE Orotidine 5'-phosphate decarboxylase active site. IIaDfKvaDIPeTN source prosite : PS00156

Display surface Download Links