eF-site ID 3s0i-A PDB Code 3s0i Chain A click to enlarge Title Crystal Structure of D48V mutant of Human Glycolipid Transfer Protein complexed with 3-O-sulfo galactosylceramide containing nervonoyl acyl chain Classification LIPID TRANSPORT Compound Glycolipid transfer protein Source Homo sapiens (Human) (GLTP_HUMAN) Sequence A:  LLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKA VISGNITKIKAVYDTNPAKFRTLQNILEVEKEMYGAEWPK VGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVN ATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSK GNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYK V Description Functional site 1) chain A residue 34 type sequence F description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 2) chain A residue 40 type sequence P description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 3) chain A residue 44 type sequence P description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 4) chain A residue 45 type sequence I description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 5) chain A residue 52 type sequence N description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 6) chain A residue 93 type sequence A description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 7) chain A residue 96 type sequence W description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 8) chain A residue 103 type sequence F description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 9) chain A residue 107 type sequence F description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 10) chain A residue 140 type sequence H description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 11) chain A residue 144 type sequence V description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 12) chain A residue 165 type sequence L description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 13) chain A residue 183 type sequence F description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 14) chain A residue 187 type sequence Y description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 15) chain A residue 207 type sequence Y description BINDING SITE FOR RESIDUE CIS A 301 source : AC1 16) chain A residue 48 type BINDING sequence V description BINDING => ECO:0000269|PubMed:15329726, ECO:0007744|PDB:1SX6 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 140 type BINDING sequence H description BINDING => ECO:0000269|PubMed:15329726, ECO:0007744|PDB:1SX6 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 207 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:15329726, ECO:0007744|PDB:1SX6 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links