eF-site ID 3rv2-A PDB Code 3rv2 Chain A click to enlarge Title Crystal structure of S-adenosylmethionine synthetase from Mycobacterium marinum Classification TRANSFERASE Compound S-adenosylmethionine synthase Source Mycobacterium marinum (strain ATCC BAA-535 / M) (METK_MYCMM) Sequence A:  GRLFTSESVTEGHPDKICDAVSDSVLDALLAADPRSRVAV ETLVTTGQVHVVGEVTTTAKEAFADITNIVRERILDIGYD SSDKGFDGASCGVNIGIGAQSPGDQGLMFGYAINDTPELM PLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYED RVPVRLDTVVISTQHADDIDLVKTLDPDIREQVLKTVLDD LAHDTLDASAVRVLVNPTGKFVLGGPMGDAGLTGRKIIVD TYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAG LAERVEVQVAYAIGKAAPVGLFVETFGSEAVDPVKIEKAI GEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVDLPW ERLDKVDDLKRAI Description Functional site 1) chain A residue 259 type sequence D description BINDING SITE FOR RESIDUE CA A 404 source : AC1 2) chain A residue 394 type sequence D description BINDING SITE FOR RESIDUE CA A 405 source : AC2 3) chain A residue 397 type sequence D description BINDING SITE FOR RESIDUE CA A 405 source : AC2 4) chain A residue 398 type sequence D description BINDING SITE FOR RESIDUE CA A 405 source : AC2 5) chain A residue 158 type sequence H description BINDING SITE FOR RESIDUE EDO A 406 source : AC3 6) chain A residue 162 type sequence R description BINDING SITE FOR RESIDUE EDO A 406 source : AC3 7) chain A residue 382 type sequence G description BINDING SITE FOR RESIDUE EDO A 406 source : AC3 8) chain A residue 383 type sequence R description BINDING SITE FOR RESIDUE EDO A 406 source : AC3 9) chain A residue 384 type sequence T description BINDING SITE FOR RESIDUE EDO A 406 source : AC3 10) chain A residue 385 type sequence D description BINDING SITE FOR RESIDUE EDO A 406 source : AC3 11) chain A residue 41 type sequence R description BINDING SITE FOR RESIDUE GOL A 407 source : AC4 12) chain A residue 43 type sequence A description BINDING SITE FOR RESIDUE GOL A 407 source : AC4 13) chain A residue 58 type sequence E description BINDING SITE FOR RESIDUE GOL A 407 source : AC4 14) chain A residue 59 type sequence V description BINDING SITE FOR RESIDUE GOL A 407 source : AC4 15) chain A residue 60 type sequence T description BINDING SITE FOR RESIDUE GOL A 407 source : AC4 16) chain A residue 290 type sequence K description BINDING SITE FOR RESIDUE GOL A 407 source : AC4 17) chain A residue 363 type sequence R description BINDING SITE FOR RESIDUE EDO B 406 source : AC7 18) chain A residue 364 type sequence D description BINDING SITE FOR RESIDUE EDO B 406 source : AC7 19) chain A residue 364 type sequence D description BINDING SITE FOR RESIDUE EDO B 407 source : AC8 20) chain A residue 394 type sequence D description BINDING SITE FOR RESIDUE EDO B 407 source : AC8 21) chain A residue 395 type sequence K description BINDING SITE FOR RESIDUE EDO B 407 source : AC8 22) chain A residue 17 type BINDING sequence H description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 58 type BINDING sequence E description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 104 type BINDING sequence Q description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 179 type BINDING sequence D description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 250 type BINDING sequence K description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 265 type BINDING sequence R description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 290 type BINDING sequence K description in other chain => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 19 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI2 30) chain A residue 45 type BINDING sequence E description BINDING => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI2 31) chain A residue 259 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 282 type BINDING sequence A description BINDING => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 286 type BINDING sequence K description BINDING => ECO:0000255|HAMAP-Rule:MF_00086 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 279-287 type prosite sequence GGGAFSGKD description ADOMET_SYNTHASE_2 S-adenosylmethionine synthase signature 2. GGGAFSgKD source prosite : PS00377

Display surface Download Links