eF-site ID 3rig-A PDB Code 3rig Chain A click to enlarge Title Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase Classification HYDROLASE Compound NAD-dependent deacetylase sirtuin-5 Source Homo sapiens (Human) (3RIG) Sequence A:  SFTARPSSSMADFRKFFAKAKHIVIISGAGVGGYWRKWQA QDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIA ECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLF KTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVE KLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHC DLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPAT NRFRFHFQGPCGTTLPEALA Description Functional site 1) chain A residue 166 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 2) chain A residue 169 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 3) chain A residue 207 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 4) chain A residue 212 type sequence C description BINDING SITE FOR RESIDUE ZN A 1001 source : AC1 5) chain A residue 74 type sequence G description BINDING SITE FOR RESIDUE NHE A 2001 source : AC2 6) chain A residue 101 type sequence F description BINDING SITE FOR RESIDUE NHE A 2001 source : AC2 7) chain A residue 102 type sequence Y description BINDING SITE FOR RESIDUE NHE A 2001 source : AC2 8) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE NHE A 2001 source : AC2 9) chain A residue 142 type sequence I description BINDING SITE FOR RESIDUE NHE A 2001 source : AC2 10) chain A residue 254 type sequence V description BINDING SITE FOR RESIDUE NHE A 2001 source : AC2 11) chain A residue 249 type MOD_RES sequence G description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 275 type MOD_RES sequence N description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 293 type MOD_RES sequence C description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 166 type MOD_RES sequence C description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 169 type MOD_RES sequence C description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 207 type MOD_RES sequence C description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI3 17) chain A residue 212 type MOD_RES sequence C description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links