eF-site ID 3rej-C PDB Code 3rej Chain C click to enlarge Title 2.55 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source null (3REJ) Sequence C:  TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVL EYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNK LLGRVTIAQGGVLPNIQSVLLPK Description Functional site 1) chain C residue 45 type sequence A description BINDING SITE FOR RESIDUE SO4 C 1102 source : AC2 2) chain C residue 46 type sequence G description BINDING SITE FOR RESIDUE SO4 C 1102 source : AC2 3) chain C residue 47 type sequence A description BINDING SITE FOR RESIDUE SO4 C 1102 source : AC2 4) chain C residue 71 type sequence R description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC4 5) chain C residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 6) chain C residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI5 7) chain C residue 104 type MOD_RES sequence Q description N5-methylglutamine => ECO:0000250 source Swiss-Prot : SWS_FT_FI6 8) chain C residue 118 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P0C0S8 source Swiss-Prot : SWS_FT_FI7 9) chain C residue 21-27 type prosite sequence AGLQFPV description HISTONE_H2A Histone H2A signature. AGLqFPV source prosite : PS00046

Display surface Download Links