eF-site ID 3rej-D PDB Code 3rej Chain D click to enlarge Title 2.55 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b) Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.2 Source null (3REJ) Sequence D:  KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFV NDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL AKHAVSEGTKAVTKYTSAK Description Functional site 1) chain D residue 87 type sequence T description BINDING SITE FOR RESIDUE SO4 C 1102 source : AC2 2) chain D residue 88 type sequence S description BINDING SITE FOR RESIDUE SO4 C 1102 source : AC2 3) chain D residue 45 type sequence V description BINDING SITE FOR RESIDUE MN D 1007 source : AC3 4) chain D residue 46 type sequence H description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC4 5) chain D residue 47 type sequence P description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC4 6) chain D residue 48 type sequence D description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC4 7) chain D residue 49 type sequence T description BINDING SITE FOR RESIDUE SO4 D 1101 source : AC4 8) chain D residue 109 type CARBOHYD sequence S description O-linked (GlcNAc) serine => ECO:0000250|UniProtKB:P62807 source Swiss-Prot : SWS_FT_FI3 9) chain D residue 117 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P0C1H4 source Swiss-Prot : SWS_FT_FI4 10) chain D residue 89-111 type prosite sequence REIQTAVRLLLPGELAKHAVSEG description HISTONE_H2B Histone H2B signature. REIQTavRlLLpGELaKHAVSEG source prosite : PS00357

Display surface Download Links