eF-site ID 3rdh-C PDB Code 3rdh Chain C click to enlarge Title X-ray induced covalent inhibition of 14-3-3 Classification SIGNALING PROTEIN/INHIBITOR Compound 14-3-3 protein zeta/delta Source null (1433Z_HUMAN) Sequence C:  GSHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELS NEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQ MAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISK KEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFD EAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS Description Functional site 1) chain C residue 49 type sequence K description BINDING SITE FOR RESIDUE 3RD C 246 source : AC5 2) chain C residue 120 type sequence K description BINDING SITE FOR RESIDUE 3RD C 246 source : AC5 3) chain C residue 169 type sequence G description BINDING SITE FOR RESIDUE 3RD C 246 source : AC5 4) chain C residue 173 type sequence N description BINDING SITE FOR RESIDUE 3RD C 246 source : AC5 5) chain C residue -2 type sequence G description BINDING SITE FOR RESIDUE NI C 247 source : AC6 6) chain C residue -1 type sequence S description BINDING SITE FOR RESIDUE NI C 247 source : AC6 7) chain C residue 0 type sequence H description BINDING SITE FOR RESIDUE NI C 247 source : AC6 8) chain C residue 1 type sequence M description BINDING SITE FOR RESIDUE NI C 247 source : AC6 9) chain C residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000250|UniProtKB:P63103 source Swiss-Prot : SWS_FT_FI1 10) chain C residue 127 type SITE sequence R description Interaction with phosphoserine on interacting protein => ECO:0000250|UniProtKB:P63103 source Swiss-Prot : SWS_FT_FI1 11) chain C residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|Ref.8, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI2 12) chain C residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 13) chain C residue 68 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI3 14) chain C residue 58 type MOD_RES sequence S description Phosphoserine; by PKA and PKB/AKT1 => ECO:0000269|PubMed:11956222, ECO:0000269|PubMed:12865427, ECO:0000269|PubMed:15883165, ECO:0000269|PubMed:16376338 source Swiss-Prot : SWS_FT_FI4 15) chain C residue 184 type MOD_RES sequence S description Phosphoserine; by MAPK8 => ECO:0000269|PubMed:15071501, ECO:0000269|PubMed:15696159 source Swiss-Prot : SWS_FT_FI5 16) chain C residue 207 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI6 17) chain C residue 210 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P63102 source Swiss-Prot : SWS_FT_FI7

Display surface Download Links