eF-site ID 3r93-ABCDEFGH PDB Code 3r93 Chain A, B, C, D, E, F, G, H click to enlarge Title Crystal structure of the chromo domain of M-phase phosphoprotein 8 bound to H3K9Me3 peptide Classification CELL CYCLE Compound M-phase phosphoprotein 8 Source Homo sapiens (Human) (3R93) Sequence A:  DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHL EDCKEVLLEFRKKIAENK B:  DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHL EDCKEVLLEFRKKIAENK C:  DVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHL EDCKEVLLEFRKKIAENK D:  EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIH LEDCKEVLLEFRKKIAENK E:  KQTARXSTGGKA F:  RTKQTARXSTGGKA G:  KQTARXSTGGKA H:  KQTARXSTGGKA Description Functional site 1) chain A residue 76-96 type prosite sequence YKVRWKGYTSDDDTWEPEIHL description CHROMO_1 Chromo domain signature. YkVRWkGYtsddd.TWEPeihL source prosite : PS00598 2) chain F residue 2 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 3) chain E residue 14 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI10 4) chain F residue 14 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI10 5) chain G residue 14 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI10 6) chain H residue 14 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI10 7) chain F residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 8) chain E residue 4 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 9) chain F residue 4 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 10) chain G residue 4 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 11) chain H residue 4 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 12) chain E residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 13) chain F residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 14) chain G residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 15) chain H residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 16) chain E residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 17) chain F residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 18) chain G residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 19) chain H residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 20) chain E residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI6 21) chain F residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI6 22) chain G residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI6 23) chain H residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P84228 source Swiss-Prot : SWS_FT_FI6 24) chain E residue 9 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 25) chain F residue 9 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 26) chain G residue 9 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 27) chain H residue 9 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 28) chain E residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI8 29) chain F residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI8 30) chain G residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI8 31) chain H residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI8 32) chain E residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:22901803 source Swiss-Prot : SWS_FT_FI9 33) chain F residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:22901803 source Swiss-Prot : SWS_FT_FI9 34) chain G residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:22901803 source Swiss-Prot : SWS_FT_FI9 35) chain H residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:18066052, ECO:0000269|PubMed:22901803 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links