eF-site ID 3qyu-A PDB Code 3qyu Chain A click to enlarge Title Crystal structure of human cyclophilin D at 1.54 A resolution at room temperature Classification ISOMERASE Compound Peptidyl-prolyl cis-trans isomerase F Source Homo sapiens (Human) (PPIF_HUMAN) Sequence A:  GNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCT GEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGS RFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDW LDGKHVVFGHVIEGMDVVKKIESFGSKSGRTSKKIVITDC GQLS Description Functional site 1) chain A residue 90-107 type prosite sequence YKGSTFHRVIPSFMCQAG description CSA_PPIASE_1 Cyclophilin-type peptidyl-prolyl cis-trans isomerase signature. YkgStFHRVIpsFMcQAG source prosite : PS00170 2) chain A residue 67 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q99KR7 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 86 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:Q99KR7 source Swiss-Prot : SWS_FT_FI2 4) chain A residue 175 type MOD_RES sequence I description N6-succinyllysine => ECO:0000250|UniProtKB:Q99KR7 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 190 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:Q99KR7 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 167 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q99KR7 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 203 type MOD_RES sequence C description S-nitrosocysteine => ECO:0000250|UniProtKB:Q99KR7 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links