eF-site ID 3qup-A PDB Code 3qup Chain A click to enlarge Title Inhibitor bound structure of the kinase domain of the murine receptor tyrosine kinase TYRO3 (Sky) Classification Transferase/transferase inhibitor Compound Tyrosine-protein kinase receptor TYRO3 Source Mus musculus (Mouse) (TYRO3_MOUSE) Sequence A:  EDVLIPFTLGRMLGKGEFGSVREAQLVKVAVKMLSSDIEE FLREAACMKEFDHPHVAKLVGVSLRSIPMVILPFMKHGDL HAFLLASRIPFNLPLQTLVRFMVDIACGMEYLSSRNFIHR DLAARNCMLAEDMTVCVADFGLLPVKWLALESLADNLYTV HSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRL KQPPECMEEVYDLMYQCWSADPKQRPSFTCLRMELENILG H Description Functional site 1) chain A residue 519 type sequence F description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 2) chain A residue 593 type sequence L description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 3) chain A residue 594 type sequence P description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 4) chain A residue 595 type sequence F description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 5) chain A residue 596 type sequence M description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 6) chain A residue 597 type sequence K description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 7) chain A residue 649 type sequence R description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 8) chain A residue 652 type sequence M description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 9) chain A residue 663 type sequence D description BINDING SITE FOR RESIDUE LUN A 1 source : AC1 10) chain A residue 514-540 type prosite sequence LGKGEFGSVREAQLVKVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGKGEFGSVReAqlkqedgsfvk.......VAVK source prosite : PS00107 11) chain A residue 641-653 type prosite sequence FIHRDLAARNCML description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FIHrDLAARNCML source prosite : PS00109 12) chain A residue 645 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 514 type BINDING sequence L description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 540 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links