eF-site ID 3qu0-A PDB Code 3qu0 Chain A click to enlarge Title CDK2 in complex with inhibitor RC-2-38 Classification TRANSFERASE/TRANSFERASE INHIBITOR Compound Cyclin-dependent kinase 2 Source Homo sapiens (Human) (CDK2_HUMAN) Sequence A:  MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRTEGV PSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLH QDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVL HRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV TLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFP GDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWA RQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHP FFQDVTKPVPHLRL Description Functional site 1) chain A residue 92 type sequence D description BINDING SITE FOR RESIDUE EDO A 450 source : AC1 2) chain A residue 195 type sequence E description BINDING SITE FOR RESIDUE EDO A 450 source : AC1 3) chain A residue 137 type sequence T description BINDING SITE FOR RESIDUE EDO A 451 source : AC2 4) chain A residue 138 type sequence E description BINDING SITE FOR RESIDUE EDO A 451 source : AC2 5) chain A residue 248 type sequence F description BINDING SITE FOR RESIDUE EDO A 451 source : AC2 6) chain A residue 257 type sequence E description BINDING SITE FOR RESIDUE EDO A 451 source : AC2 7) chain A residue 260 type sequence R description BINDING SITE FOR RESIDUE EDO A 451 source : AC2 8) chain A residue 261 type sequence S description BINDING SITE FOR RESIDUE EDO A 451 source : AC2 9) chain A residue 122 type sequence R description BINDING SITE FOR RESIDUE EDO A 452 source : AC3 10) chain A residue 150 type sequence R description BINDING SITE FOR RESIDUE EDO A 452 source : AC3 11) chain A residue 3 type sequence N description BINDING SITE FOR RESIDUE EDO A 453 source : AC4 12) chain A residue 10 type sequence I description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 13) chain A residue 18 type sequence V description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 14) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 15) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 16) chain A residue 64 type sequence V description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 17) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 18) chain A residue 81 type sequence E description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 19) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 20) chain A residue 83 type sequence L description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 21) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 22) chain A residue 85 type sequence Q description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 23) chain A residue 86 type sequence D description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 24) chain A residue 89 type sequence K description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 25) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 26) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 27) chain A residue 145 type sequence D description BINDING SITE FOR RESIDUE X40 A 454 source : AC5 28) chain A residue 127 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 29) chain A residue 132 type BINDING sequence N description BINDING => ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI3 30) chain A residue 145 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI3 31) chain A residue 9 type SITE sequence K description CDK7 binding source Swiss-Prot : SWS_FT_FI4 32) chain A residue 88 type SITE sequence K description CDK7 binding source Swiss-Prot : SWS_FT_FI4 33) chain A residue 166 type SITE sequence L description CDK7 binding source Swiss-Prot : SWS_FT_FI4 34) chain A residue 6 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI6 35) chain A residue 14 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:17095507 source Swiss-Prot : SWS_FT_FI7 36) chain A residue 15 type MOD_RES sequence Y description Phosphotyrosine; by WEE1 => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:17095507, ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI8 37) chain A residue 19 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI9 38) chain A residue 160 type MOD_RES sequence T description Phosphothreonine; by CAK and CCRK => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:14597612, ECO:0000269|PubMed:16325401, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:17570665, ECO:0000269|PubMed:20147522, ECO:0000269|PubMed:20360007, ECO:0000269|PubMed:21565702, ECO:0000305|PubMed:28666995 source Swiss-Prot : SWS_FT_FI10 39) chain A residue 10-33 type prosite sequence IGEGTYGVVYKARNKLTGEVVALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGEGTYGVVYkArnkltgev..........VALK source prosite : PS00107 40) chain A residue 123-135 type prosite sequence VLHRDLKPQNLLI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDLKpqNLLI source prosite : PS00108 41) chain A residue 10 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 33 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 81 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 86 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 129 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0007744|PubMed:22814378 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links