eF-site ID 3qqh-A PDB Code 3qqh Chain A click to enlarge Title CDK2 in complex with inhibitor L2-2 Classification TRANSFERASE/TRANSFERASE INHIBITOR Compound Cyclin-dependent kinase 2 Source Homo sapiens (Human) (CDK2_HUMAN) Sequence A:  MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRTEGV PSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLH QDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVL HRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVV TLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFP GDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWA RQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHP FFQDVTKPVPHLRL Description Functional site 1) chain A residue 174 type sequence L description BINDING SITE FOR RESIDUE EDO A 299 source : AC1 2) chain A residue 209 type sequence I description BINDING SITE FOR RESIDUE EDO A 299 source : AC1 3) chain A residue 235 type sequence D description BINDING SITE FOR RESIDUE EDO A 299 source : AC1 4) chain A residue 240 type sequence F description BINDING SITE FOR RESIDUE EDO A 299 source : AC1 5) chain A residue 250 type sequence K description BINDING SITE FOR RESIDUE EDO A 299 source : AC1 6) chain A residue 272 type sequence N description BINDING SITE FOR RESIDUE EDO A 300 source : AC2 7) chain A residue 274 type sequence R description BINDING SITE FOR RESIDUE EDO A 300 source : AC2 8) chain A residue 275 type sequence I description BINDING SITE FOR RESIDUE EDO A 300 source : AC2 9) chain A residue 276 type sequence S description BINDING SITE FOR RESIDUE EDO A 300 source : AC2 10) chain A residue 279 type sequence A description BINDING SITE FOR RESIDUE EDO A 300 source : AC2 11) chain A residue 137 type sequence T description BINDING SITE FOR RESIDUE EDO A 301 source : AC3 12) chain A residue 248 type sequence F description BINDING SITE FOR RESIDUE EDO A 301 source : AC3 13) chain A residue 257 type sequence E description BINDING SITE FOR RESIDUE EDO A 301 source : AC3 14) chain A residue 260 type sequence R description BINDING SITE FOR RESIDUE EDO A 301 source : AC3 15) chain A residue 261 type sequence S description BINDING SITE FOR RESIDUE EDO A 301 source : AC3 16) chain A residue 28 type sequence E description BINDING SITE FOR RESIDUE EDO A 302 source : AC4 17) chain A residue 29 type sequence V description BINDING SITE FOR RESIDUE EDO A 302 source : AC4 18) chain A residue 256 type sequence D description BINDING SITE FOR RESIDUE EDO A 302 source : AC4 19) chain A residue 257 type sequence E description BINDING SITE FOR RESIDUE EDO A 302 source : AC4 20) chain A residue 260 type sequence R description BINDING SITE FOR RESIDUE EDO A 302 source : AC4 21) chain A residue 10 type sequence I description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 22) chain A residue 11 type sequence G description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 23) chain A residue 12 type sequence E description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 24) chain A residue 18 type sequence V description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 25) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 26) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 27) chain A residue 81 type sequence E description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 28) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 29) chain A residue 83 type sequence L description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 30) chain A residue 84 type sequence H description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 31) chain A residue 85 type sequence Q description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 32) chain A residue 86 type sequence D description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 33) chain A residue 131 type sequence Q description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 34) chain A residue 134 type sequence L description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 35) chain A residue 145 type sequence D description BINDING SITE FOR RESIDUE X0A A 303 source : AC5 36) chain A residue 13 type sequence G description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 37) chain A residue 14 type sequence T description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 38) chain A residue 15 type sequence Y description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 39) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 40) chain A residue 127 type sequence D description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 41) chain A residue 129 type sequence K description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 42) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 43) chain A residue 145 type sequence D description BINDING SITE FOR RESIDUE PO4 A 304 source : AC6 44) chain A residue 127 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 45) chain A residue 10-33 type prosite sequence IGEGTYGVVYKARNKLTGEVVALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGEGTYGVVYkArnkltgev..........VALK source prosite : PS00107 46) chain A residue 123-135 type prosite sequence VLHRDLKPQNLLI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDLKpqNLLI source prosite : PS00108 47) chain A residue 160 type MOD_RES sequence T description Phosphothreonine; by CAK and CCRK => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:14597612, ECO:0000269|PubMed:16325401, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:17570665, ECO:0000269|PubMed:20147522, ECO:0000269|PubMed:20360007, ECO:0000269|PubMed:21565702, ECO:0000305|PubMed:28666995 source Swiss-Prot : SWS_FT_FI10 48) chain A residue 132 type BINDING sequence N description BINDING => ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI3 49) chain A residue 145 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI3 50) chain A residue 9 type SITE sequence K description CDK7 binding source Swiss-Prot : SWS_FT_FI4 51) chain A residue 88 type SITE sequence K description CDK7 binding source Swiss-Prot : SWS_FT_FI4 52) chain A residue 166 type SITE sequence L description CDK7 binding source Swiss-Prot : SWS_FT_FI4 53) chain A residue 6 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI6 54) chain A residue 14 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:17095507 source Swiss-Prot : SWS_FT_FI7 55) chain A residue 15 type MOD_RES sequence Y description Phosphotyrosine; by WEE1 => ECO:0000269|PubMed:1396589, ECO:0000269|PubMed:17095507, ECO:0007744|PubMed:19690332 source Swiss-Prot : SWS_FT_FI8 56) chain A residue 19 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI9 57) chain A residue 33 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 58) chain A residue 81 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 59) chain A residue 86 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 60) chain A residue 129 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 61) chain A residue 10 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000269|PubMed:17095507, ECO:0000269|PubMed:21565702 source Swiss-Prot : SWS_FT_FI2 62) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0007744|PubMed:22814378 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links