eF-site ID 3q3q-A PDB Code 3q3q Chain A click to enlarge Title Crystal Structure of SPAP: an novel alkaline phosphatase from bacterium Sphingomonas sp. strain BSAR-1 Classification HYDROLASE Compound Alkaline phosphatase Source Sphingomonas sp (ALPH_SPHSX) Sequence A:  AARSIAATPPKLIVAISVDQFSADLFSEYRQYYTGGLKRL TSEGAVFPRGYQSHAATETCPGHSTILTGSRPSRTGIIAN NWFDLDAKREDKNLYCAEDESQPGSSSDKYEASPLHLKVP TLGGRMKAANPATRVVSVAGKDRAAIMMGGATADQVWWLG GPQGYVSYKGVAPTPLVTQVNQAFAQRLAQPNPGFELPAQ CVSKDFPVQAGNRTVGTGRFARDAGDYKGFRISPEQDAMT LAFAAAAIENMQLGKQAQTDIISIGLSATDYVGHTFGTEG TESCIQVDRLDTELGAFFDKLDKDGIDYVVVLTADHGGHD LPERHRMNAMPMEQRVDMALTPKALNATIAEKAGLPGKKV IWSDGPSGDIYYDKGLTAAQRARVETEALKYLRAHPQVQT VFTKAEIAATPSPSGPPESWSLIQEARASFYPSRSGDLLL LLKPRVMSIPEQAVMGSVATHGSPWDTDRRVPILFWRKGM QHFEQPLGVETVDILPSLAALIKLPVPKDQIDGRCLDLVA GKDDSC Description (1)  Alkaline phosphatase (E.C.3.1.3.1) Functional site 1) chain A residue 49 type sequence D description BINDING SITE FOR RESIDUE ZN A 1559 source : AC1 2) chain A residue 89 type sequence T description BINDING SITE FOR RESIDUE ZN A 1559 source : AC1 3) chain A residue 345 type sequence D description BINDING SITE FOR RESIDUE ZN A 1559 source : AC1 4) chain A residue 346 type sequence H description BINDING SITE FOR RESIDUE ZN A 1559 source : AC1 5) chain A residue 300 type sequence D description BINDING SITE FOR RESIDUE ZN A 1561 source : AC2 6) chain A residue 304 type sequence H description BINDING SITE FOR RESIDUE ZN A 1561 source : AC2 7) chain A residue 491 type sequence H description BINDING SITE FOR RESIDUE ZN A 1561 source : AC2 8) chain A residue 357 type sequence M description BINDING SITE FOR RESIDUE CA A 566 source : AC3 9) chain A residue 547 type sequence D description BINDING SITE FOR RESIDUE CA A 566 source : AC3 10) chain A residue 549 type sequence V description BINDING SITE FOR RESIDUE CA A 566 source : AC3 11) chain A residue 551 type sequence G description BINDING SITE FOR RESIDUE CA A 566 source : AC3 12) chain A residue 553 type sequence D description BINDING SITE FOR RESIDUE CA A 566 source : AC3 13) chain A residue 103 type sequence S description BINDING SITE FOR RESIDUE GOL A 8001 source : AC4 14) chain A residue 104 type sequence R description BINDING SITE FOR RESIDUE GOL A 8001 source : AC4 15) chain A residue 442 type sequence S description BINDING SITE FOR RESIDUE GOL A 8001 source : AC4 16) chain A residue 457 type sequence R description BINDING SITE FOR RESIDUE GOL A 8001 source : AC4 17) chain A residue 542 type sequence D description BINDING SITE FOR RESIDUE GOL A 8001 source : AC4 18) chain A residue 85 type sequence A description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 19) chain A residue 86 type sequence A description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 20) chain A residue 397 type sequence S description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 21) chain A residue 398 type sequence G description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 22) chain A residue 471 type sequence L description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 23) chain A residue 492 type sequence G description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 24) chain A residue 494 type sequence P description BINDING SITE FOR RESIDUE GOL A 8002 source : AC5 25) chain A residue 236 type sequence F description BINDING SITE FOR RESIDUE GOL A 8003 source : AC6 26) chain A residue 511 type sequence Q description BINDING SITE FOR RESIDUE GOL A 8003 source : AC6 27) chain A residue 550 type sequence A description BINDING SITE FOR RESIDUE GOL A 8003 source : AC6 28) chain A residue 551 type sequence G description BINDING SITE FOR RESIDUE GOL A 8003 source : AC6 29) chain A residue 552 type sequence K description BINDING SITE FOR RESIDUE GOL A 8003 source : AC6 30) chain A residue 455 type sequence E description BINDING SITE FOR RESIDUE GOL A 8004 source : AC7 31) chain A residue 494 type sequence P description BINDING SITE FOR RESIDUE GOL A 8004 source : AC7 32) chain A residue 495 type sequence W description BINDING SITE FOR RESIDUE GOL A 8004 source : AC7 33) chain A residue 496 type sequence D description BINDING SITE FOR RESIDUE GOL A 8004 source : AC7 34) chain A residue 438 type sequence A description BINDING SITE FOR RESIDUE GOL A 8005 source : AC8 35) chain A residue 440 type sequence T description BINDING SITE FOR RESIDUE GOL A 8005 source : AC8 36) chain A residue 441 type sequence P description BINDING SITE FOR RESIDUE GOL A 8005 source : AC8 37) chain A residue 442 type sequence S description BINDING SITE FOR RESIDUE GOL A 8005 source : AC8 38) chain A residue 457 type sequence R description BINDING SITE FOR RESIDUE GOL A 8005 source : AC8 39) chain A residue 89 type sequence T description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 40) chain A residue 110 type sequence N description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 41) chain A residue 171 type sequence K description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 42) chain A residue 173 type sequence R description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 43) chain A residue 300 type sequence D description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 44) chain A residue 304 type sequence H description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 45) chain A residue 346 type sequence H description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 46) chain A residue 491 type sequence H description BINDING SITE FOR RESIDUE KOP A 1000 source : AC9 47) chain A residue 89 type ACT_SITE sequence T description Phosphothreonine intermediate => ECO:0000305|PubMed:21829507 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 49 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 49) chain A residue 89 type BINDING sequence T description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 50) chain A residue 110 type BINDING sequence N description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 51) chain A residue 300 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 52) chain A residue 304 type BINDING sequence H description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 345 type BINDING sequence D description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 54) chain A residue 346 type BINDING sequence H description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 55) chain A residue 491 type BINDING sequence H description BINDING => ECO:0000269|PubMed:21829507 source Swiss-Prot : SWS_FT_FI2 56) chain A residue 171 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links