eF-site ID 3q3f-A PDB Code 3q3f Chain A click to enlarge Title Engineering Domain-Swapped Binding Interfaces by Mutually Exclusive Folding: Insertion of Ubiquitin into position 103 of Barnase Classification HYDROLASE, PROTEIN BINDING Compound Ribonuclease/Ubiquitin chimeric protein Source null (RNBR_BACAM) Sequence A:  AQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKG NLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTS GFRNSDRILYSSDWLIYKTTDHYGGQIFVKTLTGKTITLE VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL SDYNIQKESTLHLVLRLRGGGQTFTKIR Description Functional site 1) chain A residue 1 type sequence A description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 2) chain A residue 2 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 3) chain A residue 3 type sequence V description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 4) chain A residue 146 type sequence R description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 5) chain A residue 176 type sequence R description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 6) chain A residue 177 type sequence L description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 7) chain A residue 178 type sequence R description BINDING SITE FOR RESIDUE SO4 A 189 source : AC1 8) chain A residue 62 type sequence K description BINDING SITE FOR RESIDUE SO4 A 190 source : AC2 9) chain A residue 77 type sequence N description BINDING SITE FOR RESIDUE SO4 A 190 source : AC2 10) chain A residue 79 type sequence T description BINDING SITE FOR RESIDUE SO4 A 190 source : AC2 11) chain A residue 181 type sequence G description BINDING SITE FOR RESIDUE SO4 A 190 source : AC2 12) chain A residue 146 type sequence R description BINDING SITE FOR RESIDUE SO4 A 191 source : AC3 13) chain A residue 153 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 191 source : AC3 14) chain A residue 176 type sequence R description BINDING SITE FOR RESIDUE SO4 A 191 source : AC3 15) chain A residue 57 type sequence S description BINDING SITE FOR RESIDUE SO4 A 192 source : AC4 16) chain A residue 59 type sequence R description BINDING SITE FOR RESIDUE SO4 A 192 source : AC4 17) chain A residue 118 type sequence T description BINDING SITE FOR RESIDUE SO4 A 192 source : AC4 18) chain A residue 119 type sequence L description BINDING SITE FOR RESIDUE SO4 A 192 source : AC4 19) chain A residue 120 type sequence E description BINDING SITE FOR RESIDUE SO4 A 192 source : AC4 20) chain A residue 137 type sequence K description BINDING SITE FOR RESIDUE SO4 A 192 source : AC4 21) chain A residue 27 type sequence K description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 22) chain A residue 73 type sequence E description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 23) chain A residue 83 type sequence R description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 24) chain A residue 87 type sequence R description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 25) chain A residue 102 type sequence H description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 26) chain A residue 105 type sequence G description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 27) chain A residue 120 type sequence E description BINDING SITE FOR RESIDUE SO4 A 193 source : AC5 28) chain A residue 35 type sequence W description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 29) chain A residue 37 type sequence A description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 30) chain A residue 38 type sequence S description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 31) chain A residue 39 type sequence K description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 32) chain A residue 40 type sequence G description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 33) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 34) chain A residue 83 type sequence R description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 35) chain A residue 167 type sequence K description BINDING SITE FOR RESIDUE SO4 A 194 source : AC6 36) chain A residue 72 type sequence R description BINDING SITE FOR RESIDUE SO4 A 195 source : AC7 37) chain A residue 92 type sequence S description BINDING SITE FOR RESIDUE SO4 A 195 source : AC7 38) chain A residue 72 type sequence R description BINDING SITE FOR RESIDUE SO4 A 196 source : AC8 39) chain A residue 6 type sequence T description BINDING SITE FOR RESIDUE SO4 A 197 source : AC9 40) chain A residue 7 type sequence F description BINDING SITE FOR RESIDUE SO4 A 197 source : AC9 41) chain A residue 8 type sequence D description BINDING SITE FOR RESIDUE SO4 A 197 source : AC9 42) chain A residue 77 type sequence N description BINDING SITE FOR RESIDUE SO4 A 197 source : AC9 43) chain A residue 18 type sequence H description BINDING SITE FOR RESIDUE SO4 A 198 source : BC1 44) chain A residue 94 type sequence W description BINDING SITE FOR RESIDUE SO4 A 198 source : BC1 45) chain A residue 150 type sequence A description BINDING SITE FOR RESIDUE SO4 A 198 source : BC1 46) chain A residue 59 type sequence R description BINDING SITE FOR RESIDUE SO4 A 199 source : BC2 47) chain A residue 113 type sequence T description BINDING SITE FOR RESIDUE SO4 A 200 source : BC3 48) chain A residue 115 type sequence K description BINDING SITE FOR RESIDUE SO4 A 200 source : BC3 49) chain A residue 155 type sequence E description BINDING SITE FOR RESIDUE SO4 A 201 source : BC4 50) chain A residue 158 type sequence R description BINDING SITE FOR RESIDUE SO4 A 201 source : BC4 51) chain A residue 152 type sequence K description BINDING SITE FOR RESIDUE SO4 A 202 source : BC5 52) chain A residue 153 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 202 source : BC5 53) chain A residue 149 type sequence F description BINDING SITE FOR RESIDUE SO4 A 203 source : BC6 54) chain A residue 169 type sequence S description BINDING SITE FOR RESIDUE SO4 A 203 source : BC6 55) chain A residue 170 type sequence T description BINDING SITE FOR RESIDUE SO4 A 203 source : BC6 56) chain A residue 65 type sequence G description BINDING SITE FOR RESIDUE SO4 A 204 source : BC7 57) chain A residue 69 type sequence R description BINDING SITE FOR RESIDUE SO4 A 204 source : BC7 58) chain A residue 158 type SITE sequence R description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI3 59) chain A residue 176 type SITE sequence R description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI3 60) chain A residue 172 type SITE sequence H description Essential for function source Swiss-Prot : SWS_FT_FI4 61) chain A residue 169 type MOD_RES sequence S description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI5 62) chain A residue 167 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144, ECO:0000269|PubMed:18719106 source Swiss-Prot : SWS_FT_FI14 63) chain A residue 152 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16443603, ECO:0000269|PubMed:16543144 source Swiss-Prot : SWS_FT_FI10 64) chain A residue 115 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16443603, ECO:0000269|PubMed:16543144 source Swiss-Prot : SWS_FT_FI10 65) chain A residue 170 type MOD_RES sequence T description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI6 66) chain A residue 180 type MOD_RES sequence G description ADP-ribosylglycine => ECO:0000269|PubMed:28525742 source Swiss-Prot : SWS_FT_FI7 67) chain A residue 110 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16443603 source Swiss-Prot : SWS_FT_FI8 68) chain A residue 180 type CROSSLNK sequence G description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) source Swiss-Prot : SWS_FT_FI9 69) chain A residue 131-156 type prosite sequence KAKIQDKEGIPPDQQRLIFAGKQLED description UBIQUITIN_1 Ubiquitin domain signature. KakIqDkegIPpdqQrLIFaGkqleD source prosite : PS00299 70) chain A residue 137 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:25752577 source Swiss-Prot : SWS_FT_FI13 71) chain A residue 131 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000305|PubMed:15466860 source Swiss-Prot : SWS_FT_FI11 72) chain A residue 133 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144, ECO:0000269|PubMed:25752573, ECO:0000269|PubMed:25752577, ECO:0000269|PubMed:34239127 source Swiss-Prot : SWS_FT_FI12 73) chain A residue 73 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI1 74) chain A residue 102 type ACT_SITE sequence H description Proton donor source Swiss-Prot : SWS_FT_FI2

Display surface Download Links