eF-site ID 3q29-A
PDB Code 3q29
Chain A

click to enlarge
Title Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP)
Classification SUGAR BINDING PROTEIN, PROTEIN FIBRIL
Compound Maltose-binding periplasmic protein/alpha-synuclein chimeric protein
Source (SYUA_HUMAN)
Sequence A:  KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHP
DKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIT
PDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD
LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPL
IAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIK
NKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFL
ENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT
MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEA
LKDAQTNSSSMDVFMKGLSKA
Description (1)  Maltose-binding periplasmic protein/alpha-synuclein chimeric protein


Functional site

1) chain A
residue 108-125
type prosite
ligand
sequence PIAVEALSLIYNKDLLPN
description Bacterial extracellular solute-binding proteins, family 1 signature.[GAP]-[LIVMFA]-[STAVDN]-x-{H}-x(2)-[GSAV]-[LIVMFY](2)-Y-[ND]-x(3)-[LIVMF]-x-[KNDE].
source prosite : PS01037


Display surface

Download
Links