eF-site ID 3q29-A
PDB Code 3q29
Chain A

click to enlarge
Title Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP)
Classification SUGAR BINDING PROTEIN, PROTEIN FIBRIL
Compound Maltose-binding periplasmic protein/alpha-synuclein chimeric protein
Source Homo sapiens (Human) (SYUA_HUMAN)
Sequence A:  KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHP
DKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEIT
PDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD
LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPL
IAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIK
NKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV
NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFL
ENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAAT
MENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEA
LKDAQTNSSSMDVFMKGLSKA
Description (1)  Maltose-binding periplasmic protein/alpha-synuclein chimeric protein


Functional site

1) chain A
residue 13
type
ligand
sequence N
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

2) chain A
residue 15
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

3) chain A
residue 16
type
ligand
sequence K
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

4) chain A
residue 63
type
ligand
sequence W
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

5) chain A
residue 64
type
ligand
sequence A
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

6) chain A
residue 66
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

7) chain A
residue 67
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

8) chain A
residue 112
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

9) chain A
residue 154
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

10) chain A
residue 155
type
ligand
sequence P
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

11) chain A
residue 156
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

12) chain A
residue 341
type
ligand
sequence W
description BINDING SITE FOR RESIDUE MAL A 5044
source : AC1

13) chain A
residue 151
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 391
source : AC2

14) chain A
residue 153
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 A 391
source : AC2

15) chain A
residue 154
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 391
source : AC2

16) chain A
residue 210
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 391
source : AC2

17) chain A
residue 211
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 391
source : AC2

18) chain A
residue 41
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SO4 A 392
source : AC3

19) chain A
residue 42
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 392
source : AC3

20) chain A
residue 47
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 392
source : AC3

21) chain A
residue 83
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 A 393
source : AC4

22) chain A
residue 84
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 393
source : AC4

23) chain A
residue 186
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 394
source : AC5

24) chain A
residue 187
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SO4 A 394
source : AC5

25) chain A
residue 18
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SO4 A 395
source : AC6

26) chain A
residue 19
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SO4 A 395
source : AC6

27) chain A
residue 335
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GOL A 1
source : AC7

28) chain A
residue 336
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL A 1
source : AC7

29) chain A
residue 338
type
ligand
sequence S
description BINDING SITE FOR RESIDUE GOL A 1
source : AC7

30) chain A
residue 339
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GOL A 1
source : AC7

31) chain A
residue 149
type
ligand
sequence M
description BINDING SITE FOR RESIDUE GOL A 396
source : AC8

32) chain A
residue 213
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GOL A 396
source : AC8

33) chain A
residue 216
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GOL A 396
source : AC8

34) chain A
residue 217
type
ligand
sequence A
description BINDING SITE FOR RESIDUE GOL A 396
source : AC8

35) chain A
residue 220
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GOL A 396
source : AC8

36) chain A
residue 222
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 396
source : AC8

37) chain A
residue 345
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 394
source : BC5

38) chain A
residue 203
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 C 395
source : BC6

39) chain A
residue 356
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL C 396
source : BC7

40) chain A
residue 360
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL C 396
source : BC7

41) chain A
residue 367
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL C 397
source : BC8

42) chain A
residue 297
type METAL
ligand
sequence D
description Copper. {ECO:0000305}
source Swiss-Prot : SWS_FT_FI1

43) chain A
residue 108-125
type prosite
ligand
sequence PIAVEALSLIYNKDLLPN
description Bacterial extracellular solute-binding proteins, family 1 signature. [GAP]-[LIVMFA]-[STAVDN]-x-{H}-x(2)-[GSAV]-[LIVMFY](2)-Y-[ND]-x(3)
source prosite : PS01037

44) chain A
residue 13
type binding
ligand MAL: MALTOSE
sequence N
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

45) chain A
residue 15-16
type binding
ligand MAL: MALTOSE
sequence DK
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

46) chain A
residue 45
type binding
ligand MAL: MALTOSE
sequence E
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

47) chain A
residue 63-64
type binding
ligand MAL: MALTOSE
sequence WA
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

48) chain A
residue 66-67
type binding
ligand MAL: MALTOSE
sequence DR
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

49) chain A
residue 112
type binding
ligand MAL: MALTOSE
sequence E
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

50) chain A
residue 154-157
type binding
ligand MAL: MALTOSE
sequence EPYF
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

51) chain A
residue 231
type binding
ligand MAL: MALTOSE
sequence W
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

52) chain A
residue 331
type binding
ligand MAL: MALTOSE
sequence M
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

53) chain A
residue 341
type binding
ligand MAL: MALTOSE
sequence W
description MALTOSE binding site
source pdb_hetatom : MAL_3q29_A_5044

54) chain A
residue 149
type binding
ligand GOL: GLYCEROL
sequence M
description GLYCEROL binding site
source pdb_hetatom : GOL_3q29_A_396

55) chain A
residue 212-214
type binding
ligand GOL: GLYCEROL
sequence SIA
description GLYCEROL binding site
source pdb_hetatom : GOL_3q29_A_396

56) chain A
residue 216-217
type binding
ligand GOL: GLYCEROL
sequence AA
description GLYCEROL binding site
source pdb_hetatom : GOL_3q29_A_396

57) chain A
residue 220
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_3q29_A_396

58) chain A
residue 222
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_3q29_A_396

59) chain A
residue 335-339
type binding
ligand GOL: GLYCEROL
sequence PQMSA
description GLYCEROL binding site
source pdb_hetatom : GOL_3q29_A_1


Display surface

Download
Links