eF-site ID 3pzc-B PDB Code 3pzc Chain B click to enlarge Title Crystal structure of class II aaRS homologue (Bll0957) complexed with Coenzyme A Classification LIGASE Compound Amino acid--[acyl-carrier-protein] ligase 1 Source null (AACL1_BRAJA) Sequence B:  DPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSH REAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHG TEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPI AASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREY VCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYALKFE LLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHT GCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQ Description Functional site 1) chain B residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN B 1000 source : AC5 2) chain B residue 176 type sequence E description BINDING SITE FOR RESIDUE ZN B 1000 source : AC5 3) chain B residue 279 type sequence C description BINDING SITE FOR RESIDUE ZN B 1000 source : AC5 4) chain B residue 159 type sequence R description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 5) chain B residue 161 type sequence E description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 6) chain B residue 167 type sequence D description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 7) chain B residue 168 type sequence R description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 8) chain B residue 169 type sequence L description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 9) chain B residue 172 type sequence F description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 10) chain B residue 174 type sequence M description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 11) chain B residue 235 type sequence K description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 12) chain B residue 237 type sequence E description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 13) chain B residue 253 type sequence S description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 14) chain B residue 255 type sequence N description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 15) chain B residue 281 type sequence A description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 16) chain B residue 286 type sequence R description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 17) chain B residue 45 type sequence S description BINDING SITE FOR RESIDUE ACT B 1004 source : AC7 18) chain B residue 174 type sequence M description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 19) chain B residue 250 type sequence A description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 20) chain B residue 251 type sequence C description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 21) chain B residue 252 type sequence M description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 22) chain B residue 253 type sequence S description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 23) chain B residue 281 type sequence A description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 24) chain B residue 283 type sequence G description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 25) chain B residue 176 type sequence E description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 26) chain B residue 255 type sequence N description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 27) chain B residue 257 type sequence H description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 28) chain B residue 279 type sequence C description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 29) chain B residue 131 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 30) chain B residue 159 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 31) chain B residue 161 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 32) chain B residue 168 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 33) chain B residue 176 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 34) chain B residue 235 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 35) chain B residue 250 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 36) chain B residue 279 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 37) chain B residue 286 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links