eF-site ID 3pzc-AB PDB Code 3pzc Chain A, B click to enlarge Title Crystal structure of class II aaRS homologue (Bll0957) complexed with Coenzyme A Classification LIGASE Compound Amino acid--[acyl-carrier-protein] ligase 1 Source Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) (AACL1_BRAJA) Sequence A:  ADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITS HREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLH GTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYP IAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMRE YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDP FFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNY HREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHG TDLSAWPAKVRDILGL B:  DPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSH REAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHG TEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPI AASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREY VCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYALKFE LLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHT GCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQ Description Functional site 1) chain A residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 2) chain A residue 176 type sequence E description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 3) chain A residue 279 type sequence C description BINDING SITE FOR RESIDUE ZN A 1000 source : AC1 4) chain A residue 159 type sequence R description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 5) chain A residue 161 type sequence E description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 6) chain A residue 169 type sequence L description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 7) chain A residue 172 type sequence F description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 8) chain A residue 174 type sequence M description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 9) chain A residue 176 type sequence E description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 10) chain A residue 235 type sequence K description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 11) chain A residue 250 type sequence A description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 12) chain A residue 251 type sequence C description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 13) chain A residue 252 type sequence M description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 14) chain A residue 253 type sequence S description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 15) chain A residue 279 type sequence C description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 16) chain A residue 283 type sequence G description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 17) chain A residue 286 type sequence R description BINDING SITE FOR RESIDUE GAP A 1001 source : AC2 18) chain A residue 39 type sequence R description BINDING SITE FOR RESIDUE GOL A 1010 source : AC3 19) chain A residue 44 type sequence E description BINDING SITE FOR RESIDUE GOL A 1010 source : AC3 20) chain A residue 173 type sequence R description BINDING SITE FOR RESIDUE GOL A 1010 source : AC3 21) chain A residue 285 type sequence D description BINDING SITE FOR RESIDUE GOL A 1010 source : AC3 22) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE GOL A 1011 source : AC4 23) chain A residue 216 type sequence P description BINDING SITE FOR RESIDUE GOL A 1011 source : AC4 24) chain A residue 237 type sequence E description BINDING SITE FOR RESIDUE GOL A 1011 source : AC4 25) chain A residue 286 type sequence R description BINDING SITE FOR RESIDUE GOL A 1011 source : AC4 26) chain B residue 131 type sequence C description BINDING SITE FOR RESIDUE ZN B 1000 source : AC5 27) chain B residue 176 type sequence E description BINDING SITE FOR RESIDUE ZN B 1000 source : AC5 28) chain B residue 279 type sequence C description BINDING SITE FOR RESIDUE ZN B 1000 source : AC5 29) chain B residue 159 type sequence R description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 30) chain B residue 161 type sequence E description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 31) chain B residue 167 type sequence D description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 32) chain B residue 168 type sequence R description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 33) chain B residue 169 type sequence L description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 34) chain B residue 172 type sequence F description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 35) chain B residue 174 type sequence M description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 36) chain B residue 235 type sequence K description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 37) chain B residue 237 type sequence E description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 38) chain B residue 253 type sequence S description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 39) chain B residue 255 type sequence N description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 40) chain B residue 281 type sequence A description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 41) chain B residue 286 type sequence R description BINDING SITE FOR RESIDUE COA B 1001 source : AC6 42) chain B residue 45 type sequence S description BINDING SITE FOR RESIDUE ACT B 1004 source : AC7 43) chain B residue 174 type sequence M description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 44) chain B residue 250 type sequence A description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 45) chain B residue 251 type sequence C description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 46) chain B residue 252 type sequence M description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 47) chain B residue 253 type sequence S description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 48) chain B residue 281 type sequence A description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 49) chain B residue 283 type sequence G description BINDING SITE FOR RESIDUE ACT B 1003 source : AC8 50) chain B residue 176 type sequence E description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 51) chain B residue 255 type sequence N description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 52) chain B residue 257 type sequence H description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 53) chain B residue 279 type sequence C description BINDING SITE FOR RESIDUE ACT B 1002 source : AC9 54) chain A residue 131 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 55) chain B residue 131 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 56) chain B residue 159 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 57) chain B residue 161 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 58) chain B residue 168 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 59) chain B residue 176 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 60) chain B residue 235 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 61) chain B residue 250 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 62) chain B residue 279 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 63) chain B residue 286 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 64) chain A residue 159 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 65) chain A residue 161 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 66) chain A residue 168 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 67) chain A residue 176 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 68) chain A residue 235 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI1 69) chain A residue 250 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 70) chain A residue 279 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 71) chain A residue 286 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links