eF-site ID 3pvt-C
PDB Code 3pvt
Chain C

click to enlarge
Title The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with 3-hydroxybutanoyl-CoA
Classification OXIDOREDUCTASE
Compound Phenylacetic acid degradation protein paaA
Source Escherichia coli (strain K12) (PAAC_ECOLI)
Sequence C:  SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALAN
IGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNL
LLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLA
AISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAIN
KLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVF
AGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQYLQ
RVLPGQQW
Description (1)  Phenylacetic acid degradation protein paaA (E.C.1.14.13.-), Phenylacetic acid degradation protein paaC (E.C.1.14.13.-)


Functional site

1) chain C
residue 71
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL C 249
source : AC4

2) chain C
residue 240
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL C 249
source : AC4

3) chain C
residue 244
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GOL C 249
source : AC4

4) chain C
residue 245
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL C 249
source : AC4

5) chain C
residue 7
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

6) chain C
residue 10
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

7) chain C
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

8) chain C
residue 14
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

9) chain C
residue 103
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

10) chain C
residue 176
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

11) chain C
residue 188
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

12) chain C
residue 221
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GOL C 250
source : AC5

13) chain C
residue 24
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL C 251
source : AC6

14) chain C
residue 25
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GOL C 251
source : AC6

15) chain C
residue 87
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL C 251
source : AC6

16) chain C
residue 88
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GOL C 251
source : AC6

17) chain C
residue 24-25
type binding
ligand GOL: GLYCEROL
sequence EW
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_251

18) chain C
residue 28
type binding
ligand GOL: GLYCEROL
sequence H
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_251

19) chain C
residue 87-88
type binding
ligand GOL: GLYCEROL
sequence NG
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_251

20) chain C
residue 7
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

21) chain C
residue 10-11
type binding
ligand GOL: GLYCEROL
sequence RL
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

22) chain C
residue 14
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

23) chain C
residue 78
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

24) chain C
residue 80
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

25) chain C
residue 103
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

26) chain C
residue 169
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

27) chain C
residue 171
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

28) chain C
residue 176
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

29) chain C
residue 188
type binding
ligand GOL: GLYCEROL
sequence P
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

30) chain C
residue 221
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_250

31) chain C
residue 64
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_249

32) chain C
residue 66-67
type binding
ligand GOL: GLYCEROL
sequence DT
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_249

33) chain C
residue 71
type binding
ligand GOL: GLYCEROL
sequence T
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_249

34) chain C
residue 240
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_249

35) chain C
residue 244-246
type binding
ligand GOL: GLYCEROL
sequence PGQ
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_249


Display surface

Download
Links