eF-site ID 3pvt-B
PDB Code 3pvt
Chain B

click to enlarge
Title The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with 3-hydroxybutanoyl-CoA
Classification OXIDOREDUCTASE
Compound Phenylacetic acid degradation protein paaA
Source Escherichia coli (strain K12) (PAAC_ECOLI)
Sequence B:  SNQLTAYTLRLGDNCLVLSQRLGEWCGHAPELEIDLALAN
IGLDLLGQARNFLSYAAELAGEGDEDTLAFTRDERQFSNL
LLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLA
AISAKAIKEARYHLRFSRGWLERLGNGTDVSGQKMQQAIN
KLWRFTAELFDADEIDIALSEEGIAVDPRTLRAAWEAEVF
AGINEATLNVPQEQAYRTGGKKGLHTEHLGPMLAEMQ
Description (1)  Phenylacetic acid degradation protein paaA (E.C.1.14.13.-), Phenylacetic acid degradation protein paaC (E.C.1.14.13.-)


Functional site

1) chain B
residue 7
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

2) chain B
residue 10
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

3) chain B
residue 11
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

4) chain B
residue 14
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

5) chain B
residue 103
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

6) chain B
residue 176
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

7) chain B
residue 188
type
ligand
sequence P
description BINDING SITE FOR RESIDUE GOL B 249
source : AC3

8) chain B
residue 7
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

9) chain B
residue 10-11
type binding
ligand GOL: GLYCEROL
sequence RL
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

10) chain B
residue 14
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

11) chain B
residue 78
type binding
ligand GOL: GLYCEROL
sequence S
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

12) chain B
residue 80
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

13) chain B
residue 103
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

14) chain B
residue 168-169
type binding
ligand GOL: GLYCEROL
sequence EL
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

15) chain B
residue 171
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

16) chain B
residue 176
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

17) chain B
residue 186
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

18) chain B
residue 188
type binding
ligand GOL: GLYCEROL
sequence P
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249

19) chain B
residue 221
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_B_249


Display surface

Download
Links