eF-site ID 3pvt-A
PDB Code 3pvt
Chain A

click to enlarge
Title The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with 3-hydroxybutanoyl-CoA
Classification OXIDOREDUCTASE
Compound Phenylacetic acid degradation protein paaA
Source Escherichia coli (strain K12) (PAAC_ECOLI)
Sequence A:  MRSTQEERFEQRIAQETAIEPQDWMPDAYRKTLIRQIGQH
AHSEIVGMLPEGNWITRAPTLRRKAILLAKVQDEAGHGLY
LYSAAETLGCAREDIYQKMLDGRMKYSSIFNYPTLSWADI
GVIGWLVDGAAIVNQVALCRTSYGPYARAMVKICKEESFH
QRQGFEACMALAQGSEAQKQMLQDAINRFWWPALMMFGPN
DDNSPNSARSLTWKIKRFTNDELRQRFVDNTVPQVEMLGM
TVPDPDLHFDTESGHYRFGEIDWQEFNEVINGRGICNQER
LDAKRKAWEEGTWVREAALAHAQK
Description (1)  Phenylacetic acid degradation protein paaA (E.C.1.14.13.-), Phenylacetic acid degradation protein paaC (E.C.1.14.13.-)


Functional site

1) chain A
residue 33
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

2) chain A
residue 34
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

3) chain A
residue 37
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

4) chain A
residue 38
type
ligand
sequence H
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

5) chain A
residue 41
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

6) chain A
residue 42
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

7) chain A
residue 103
type
ligand
sequence K
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

8) chain A
residue 104
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

9) chain A
residue 105
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

10) chain A
residue 106
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

11) chain A
residue 129
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

12) chain A
residue 132
type
ligand
sequence N
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

13) chain A
residue 133
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

14) chain A
residue 144
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

15) chain A
residue 193
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

16) chain A
residue 194
type
ligand
sequence M
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

17) chain A
residue 195
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

18) chain A
residue 196
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

19) chain A
residue 197
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

20) chain A
residue 202
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

21) chain A
residue 203
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

22) chain A
residue 204
type
ligand
sequence N
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

23) chain A
residue 214
type
ligand
sequence K
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

24) chain A
residue 218
type
ligand
sequence N
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

25) chain A
residue 264
type
ligand
sequence F
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

26) chain A
residue 268
type
ligand
sequence I
description BINDING SITE FOR RESIDUE 3HC A 310
source : AC1

27) chain A
residue 198
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

28) chain A
residue 219
type
ligand
sequence D
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

29) chain A
residue 222
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

30) chain A
residue 256
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

31) chain A
residue 258
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

32) chain A
residue 259
type
ligand
sequence I
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

33) chain A
residue 261
type
ligand
sequence W
description BINDING SITE FOR RESIDUE GOL A 311
source : AC2

34) chain A
residue 33-34
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence RQ
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

35) chain A
residue 37-38
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence QH
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

36) chain A
residue 41-42
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence SE
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

37) chain A
residue 103-106
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence KYSS
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

38) chain A
residue 108
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence F
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

39) chain A
residue 128-129
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence AA
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

40) chain A
residue 132-133
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence NQ
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

41) chain A
residue 136
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence L
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

42) chain A
residue 144
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence Y
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

43) chain A
residue 155
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence E
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

44) chain A
residue 193-197
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence MMFGP
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

45) chain A
residue 202-205
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence SPNS
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

46) chain A
residue 208
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence S
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

47) chain A
residue 214
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence K
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

48) chain A
residue 218
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence N
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

49) chain A
residue 264
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence F
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

50) chain A
residue 268
type binding
ligand 3HC: 3-HYDROXYBUTANOYL-COENZYME A
sequence I
description 3-HYDROXYBUTANOYL-COENZYME A binding site
source pdb_hetatom : 3HC_3pvt_A_310

51) chain A
residue 198
type binding
ligand GOL: GLYCEROL
sequence N
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_A_311

52) chain A
residue 219
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_A_311

53) chain A
residue 222
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_A_311

54) chain A
residue 256-259
type binding
ligand GOL: GLYCEROL
sequence FGEI
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_A_311

55) chain A
residue 261
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_A_311

56) chain A
residue 284
type binding
ligand GOL: GLYCEROL
sequence K
description GLYCEROL binding site
source pdb_hetatom : GOL_3pvt_C_251


Display surface

Download
Links