eF-site ID 3pt2-A PDB Code 3pt2 Chain A click to enlarge Title Structure of a viral OTU domain protease bound to Ubiquitin Classification HYDROLASE/PROTEIN BINDING Compound RNA polymerase Source Homo sapiens (Human) (Q5U5U6_HUMAN) Sequence A:  PGXDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDG NCFYHSIAELTXPNKTDHSYHYIKRLTESAARKYYQEEPE ARLVGLSLEDYLKRXLSDNEWGSTLEASXLAKEXGITIII WTVAASDEVEAGIKFGDGDVFTAVNLLHSGQTHFDALRIL PQFE Description Functional site 1) chain A residue 50 type sequence X description BINDING SITE FOR RESIDUE SO4 A 185 source : AC1 2) chain A residue 52 type sequence N description BINDING SITE FOR RESIDUE SO4 A 185 source : AC1 3) chain A residue 54 type sequence T description BINDING SITE FOR RESIDUE SO4 A 185 source : AC1 4) chain A residue 57 type sequence S description BINDING SITE FOR RESIDUE SO4 A 185 source : AC1 5) chain A residue 60 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 185 source : AC1 6) chain A residue 63 type sequence R description BINDING SITE FOR RESIDUE SO4 A 185 source : AC1 7) chain A residue 49 type sequence T description BINDING SITE FOR RESIDUE ACT A 186 source : AC2 8) chain A residue 37 type sequence D description BINDING SITE FOR RESIDUE 4LJ B 76 source : AC3 9) chain A residue 38 type sequence G description BINDING SITE FOR RESIDUE 4LJ B 76 source : AC3 10) chain A residue 40 type sequence C description BINDING SITE FOR RESIDUE 4LJ B 76 source : AC3 11) chain A residue 99 type sequence W description BINDING SITE FOR RESIDUE 4LJ B 76 source : AC3 12) chain A residue 150 type sequence T description BINDING SITE FOR RESIDUE 4LJ B 76 source : AC3 13) chain A residue 151 type sequence H description BINDING SITE FOR RESIDUE 4LJ B 76 source : AC3 14) chain A residue 75 type sequence E description BINDING SITE FOR RESIDUE SO4 B 77 source : AC4 15) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE SO4 B 78 source : AC5 16) chain A residue 99 type sequence W description BINDING SITE FOR RESIDUE SO4 B 78 source : AC5 17) chain A residue 40 type ACT_SITE sequence C description For ubiquitin thioesterase activity => ECO:0000269|PubMed:21228232, ECO:0000269|PubMed:21266548 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 153 type ACT_SITE sequence D description For ubiquitin thioesterase activity => ECO:0000269|PubMed:21228232, ECO:0000269|PubMed:21266548 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 151 type ACT_SITE sequence H description For ubiquitin thioesterase activity => ECO:0000269|PubMed:21228232, ECO:0000269|PubMed:21266548, ECO:0000305|PubMed:18078692 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links