eF-site ID 3ppp-B
PDB Code 3ppp
Chain B

click to enlarge
Title Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of Bacillus subtilis ABC transporter OpuC
Classification TRANSPORT PROTEIN
Compound Glycine betaine/carnitine/choline-binding protein
Source Bacillus subtilis (strain 168) (OPUCC_BACSU)
Sequence B:  DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGS
NYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKA
LNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHI
NTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEF
GTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKIL
KDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDT
ETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Description (1)  Glycine betaine/carnitine/choline-binding protein


Functional site

1) chain B
residue 39
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

2) chain B
residue 91
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

3) chain B
residue 94
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

4) chain B
residue 135
type
ligand
sequence N
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

5) chain B
residue 137
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

6) chain B
residue 217
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

7) chain B
residue 241
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

8) chain B
residue 39
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Q
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

9) chain B
residue 41
type binding
ligand BET: TRIMETHYL GLYCINE
sequence M
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

10) chain B
residue 91
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

11) chain B
residue 94
type binding
ligand BET: TRIMETHYL GLYCINE
sequence T
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

12) chain B
residue 135-137
type binding
ligand BET: TRIMETHYL GLYCINE
sequence NTY
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

13) chain B
residue 217
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

14) chain B
residue 241
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401


Display surface

Download
Links