eF-site ID 3ppp-AB
PDB Code 3ppp
Chain A, B

click to enlarge
Title Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of Bacillus subtilis ABC transporter OpuC
Classification TRANSPORT PROTEIN
Compound Glycine betaine/carnitine/choline-binding protein
Source Bacillus subtilis (strain 168) (OPUCC_BACSU)
Sequence A:  DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGS
NYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKA
LNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHI
NTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEF
GTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKIL
KDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDT
ETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
B:  DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGS
NYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKA
LNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHI
NTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEF
GTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKIL
KDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDT
ETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Description (1)  Glycine betaine/carnitine/choline-binding protein


Functional site

1) chain A
residue 39
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE BET A 401
source : AC1

2) chain A
residue 91
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET A 401
source : AC1

3) chain A
residue 94
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BET A 401
source : AC1

4) chain A
residue 135
type
ligand
sequence N
description BINDING SITE FOR RESIDUE BET A 401
source : AC1

5) chain A
residue 137
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET A 401
source : AC1

6) chain A
residue 241
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET A 401
source : AC1

7) chain B
residue 39
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

8) chain B
residue 91
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

9) chain B
residue 94
type
ligand
sequence T
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

10) chain B
residue 135
type
ligand
sequence N
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

11) chain B
residue 137
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

12) chain B
residue 217
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

13) chain B
residue 241
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BET B 401
source : AC2

14) chain A
residue 39
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Q
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

15) chain A
residue 41
type binding
ligand BET: TRIMETHYL GLYCINE
sequence M
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

16) chain A
residue 91
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

17) chain A
residue 94
type binding
ligand BET: TRIMETHYL GLYCINE
sequence T
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

18) chain A
residue 135-137
type binding
ligand BET: TRIMETHYL GLYCINE
sequence NTY
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

19) chain A
residue 217
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

20) chain A
residue 241
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_A_401

21) chain B
residue 39
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Q
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

22) chain B
residue 41
type binding
ligand BET: TRIMETHYL GLYCINE
sequence M
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

23) chain B
residue 91
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

24) chain B
residue 94
type binding
ligand BET: TRIMETHYL GLYCINE
sequence T
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

25) chain B
residue 135-137
type binding
ligand BET: TRIMETHYL GLYCINE
sequence NTY
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

26) chain B
residue 217
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401

27) chain B
residue 241
type binding
ligand BET: TRIMETHYL GLYCINE
sequence Y
description TRIMETHYL GLYCINE binding site
source pdb_hetatom : BET_3ppp_B_401


Display surface

Download
Links