eF-site ID 3plk-A PDB Code 3plk Chain A click to enlarge Title Bovine trypsin variant X(tripleIle227) in complex with small molecule inhibitor Classification HYDROLASE/HYDROLASE INHIBITOR Compound Cationic trypsin Source null (TRY1_BOVIN) Sequence A:  IVGGYTCGANTVPYQVSLNSGYHFCGGSLLNSQWVVSAAH CYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSET YNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG WGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNM FCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQK NKPGIYTKVCNYVSWIKQTIASN Description Functional site 1) chain A residue 70 type sequence E description BINDING SITE FOR RESIDUE CA A 480 source : AC1 2) chain A residue 72 type sequence N description BINDING SITE FOR RESIDUE CA A 480 source : AC1 3) chain A residue 75 type sequence V description BINDING SITE FOR RESIDUE CA A 480 source : AC1 4) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE CA A 480 source : AC1 5) chain A residue 98 type sequence T description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 6) chain A residue 99 type sequence Y description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 7) chain A residue 128 type sequence C description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 8) chain A residue 130 type sequence S description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 9) chain A residue 189 type sequence D description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 10) chain A residue 190 type sequence A description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 11) chain A residue 192 type sequence Q description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 12) chain A residue 195 type sequence S description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 13) chain A residue 215 type sequence W description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 14) chain A residue 216 type sequence G description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 15) chain A residue 219 type sequence G description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 16) chain A residue 220 type sequence C description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 17) chain A residue 226 type sequence G description BINDING SITE FOR RESIDUE ANH A 481 source : AC2 18) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE SO4 A 482 source : AC3 19) chain A residue 192 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 482 source : AC3 20) chain A residue 193 type sequence G description BINDING SITE FOR RESIDUE SO4 A 482 source : AC3 21) chain A residue 195 type sequence S description BINDING SITE FOR RESIDUE SO4 A 482 source : AC3 22) chain A residue 80 type sequence E description BINDING SITE FOR RESIDUE GOL A 483 source : AC4 23) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE GOL A 483 source : AC4 24) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE GOL A 483 source : AC4 25) chain A residue 53-58 type prosite sequence VSAAHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. VSAAHC source prosite : PS00134 26) chain A residue 189-200 type prosite sequence DACQGDSGGPVV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DAcqGDSGGPVV source prosite : PS00135 27) chain A residue 57 type ACT_SITE sequence H description Charge relay system source Swiss-Prot : SWS_FT_FI1 28) chain A residue 102 type ACT_SITE sequence D description Charge relay system source Swiss-Prot : SWS_FT_FI1 29) chain A residue 195 type ACT_SITE sequence S description Charge relay system source Swiss-Prot : SWS_FT_FI1 30) chain A residue 75 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 31) chain A residue 80 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 32) chain A residue 189 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 33) chain A residue 192 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI2 34) chain A residue 195 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 35) chain A residue 70 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 36) chain A residue 72 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links