eF-site ID 3pft-A PDB Code 3pft Chain A click to enlarge Title Crystal Structure of Untagged C54A Mutant Flavin Reductase (DszD) in Complex with FMN From Mycobacterium goodii Classification OXIDOREDUCTASE Compound Flavin reductase Source Mycobacterium goodii (B6CDL6_9MYCO) Sequence A:  DLSPTSLREAFGHFPSGVIAIAAEVDGTRVGLAASTFVPV SLEPPLVAFAVQNSSTTWPKLKDLPSLGISVLGEAHDTAA RTLAAKTGDRFAGLETESRDSGAVFINGTSVWLESAIEQL VPAGDHTIVVLRVSDIVINEAVPPIVFHRSAFRKLG Description Functional site 1) chain A residue 37 type sequence A description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 2) chain A residue 38 type sequence A description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 3) chain A residue 39 type sequence S description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 4) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 5) chain A residue 54 type sequence A description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 6) chain A residue 55 type sequence V description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 7) chain A residue 56 type sequence Q description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 8) chain A residue 59 type sequence S description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 9) chain A residue 60 type sequence T description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 10) chain A residue 61 type sequence T description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 11) chain A residue 88 type sequence A description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 12) chain A residue 94 type sequence R description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 13) chain A residue 151 type sequence F description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 14) chain A residue 156 type sequence F description BINDING SITE FOR RESIDUE FMN A 401 source : AC1 15) chain A residue 99 type sequence E description BINDING SITE FOR RESIDUE FMN B 402 source : AC2 16) chain A residue 34 type BINDING sequence V description BINDING => ECO:0007744|PDB:3PFT source Swiss-Prot : SWS_FT_FI1 17) chain A residue 41 type BINDING sequence F description BINDING => ECO:0007744|PDB:3PFT source Swiss-Prot : SWS_FT_FI1 18) chain A residue 58 type BINDING sequence S description BINDING => ECO:0007744|PDB:3PFT source Swiss-Prot : SWS_FT_FI1 19) chain A residue 92 type BINDING sequence G description BINDING => ECO:0007744|PDB:3PFT source Swiss-Prot : SWS_FT_FI1 20) chain A residue 98 type BINDING sequence L description BINDING => ECO:0007744|PDB:3PFT source Swiss-Prot : SWS_FT_FI1 21) chain A residue 155 type BINDING sequence A description BINDING => ECO:0007744|PDB:3PFT source Swiss-Prot : SWS_FT_FI1

Display surface Download Links