eF-site ID 3pd4-B PDB Code 3pd4 Chain B click to enlarge Title Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with glycyl-3'-aminoadenosine Classification LIGASE Compound Threonyl-tRNA synthetase Source null (SYT_PYRAB) Sequence B:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY KAFKISCKGHPLAELSRTIVPEE Description Functional site 1) chain B residue 134 type sequence E description BINDING SITE FOR RESIDUE A3G A 500 source : AC1 2) chain B residue 19 type sequence A description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 3) chain B residue 43 type sequence I description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 4) chain B residue 45 type sequence V description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 5) chain B residue 81 type sequence F description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 6) chain B residue 82 type sequence A description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 7) chain B residue 89 type sequence A description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 8) chain B residue 117 type sequence F description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 9) chain B residue 118 type sequence G description BINDING SITE FOR RESIDUE A3G B 501 source : AC2 10) chain B residue 119 type sequence Y description BINDING SITE FOR RESIDUE A3G B 501 source : AC2

Display surface Download Links