eF-site ID 3pcn-R PDB Code 3pcn Chain R click to enlarge Title STRUCTURE OF PROTOCATECHUATE 3,4-DIOXYGENASE COMPLEXED WITH 3,4-DIHYDROXYPHENYLACETATE Classification DIOXYGENASE Compound PROTOCATECHUATE 3,4-DIOXYGENASE Source ORGANISM_SCIENTIFIC: Pseudomonas putida; Sequence R:  PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIP QSISETTGPNFSHLGFGAHDHDLLLNFGLPIGERIIVAGR VVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNF GGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHF GISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQ LIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFE Description Functional site 1) chain R residue 324 type sequence Y description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 2) chain R residue 326 type sequence T description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 3) chain R residue 400 type sequence W description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 4) chain R residue 408 type sequence Y description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 5) chain R residue 413 type sequence D description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 6) chain R residue 447 type sequence Y description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 7) chain R residue 448 type sequence P description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 8) chain R residue 449 type sequence W description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 9) chain R residue 450 type sequence R description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 10) chain R residue 457 type sequence R description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 11) chain R residue 460 type sequence H description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 12) chain R residue 462 type sequence H description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 13) chain R residue 477 type sequence Q description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 14) chain R residue 491 type sequence I description SITE "ACF" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : ACF 15) chain R residue 304 type sequence D description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 16) chain R residue 307 type sequence R description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 17) chain R residue 339 type sequence I description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 18) chain R residue 340 type sequence P description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 19) chain R residue 341 type sequence Q description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 20) chain R residue 342 type sequence S description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 21) chain R residue 343 type sequence I description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 22) chain R residue 344 type sequence S description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 23) chain R residue 345 type sequence E description SITE "VEF" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS F AND R. source : VEF 24) chain R residue 408 type sequence Y description BINDING SITE FOR RESIDUE FE R 600 source : AC6 25) chain R residue 460 type sequence H description BINDING SITE FOR RESIDUE FE R 600 source : AC6 26) chain R residue 462 type sequence H description BINDING SITE FOR RESIDUE FE R 600 source : AC6 27) chain R residue 361 type sequence H description BINDING SITE FOR RESIDUE BME R 601 source : BC8 28) chain R residue 429 type sequence C description BINDING SITE FOR RESIDUE BME R 601 source : BC8 29) chain R residue 438 type sequence S description BINDING SITE FOR RESIDUE BME R 601 source : BC8 30) chain R residue 324 type sequence Y description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 31) chain R residue 408 type sequence Y description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 32) chain R residue 447 type sequence Y description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 33) chain R residue 449 type sequence W description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 34) chain R residue 457 type sequence R description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 35) chain R residue 460 type sequence H description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 36) chain R residue 462 type sequence H description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 37) chain R residue 477 type sequence Q description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 38) chain R residue 491 type sequence I description BINDING SITE FOR RESIDUE DHY R 550 source : BC9 39) chain R residue 409 type catalytic sequence R description 936 source MCSA : MCSA6 40) chain R residue 448 type catalytic sequence P description 936 source MCSA : MCSA6 41) chain R residue 458 type catalytic sequence P description 936 source MCSA : MCSA6 42) chain R residue 461 type catalytic sequence I description 936 source MCSA : MCSA6 43) chain R residue 463 type catalytic sequence F description 936 source MCSA : MCSA6 44) chain R residue 409 type BINDING sequence R description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 45) chain R residue 448 type BINDING sequence P description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 46) chain R residue 461 type BINDING sequence I description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 47) chain R residue 463 type BINDING sequence F description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links