eF-site ID 3pcf-M PDB Code 3pcf Chain M click to enlarge Title STRUCTURE OF PROTOCATECHUATE 3,4-DIOXYGENASE COMPLEXED WITH 3-FLURO-4-HYDROXYBENZOATE Classification DIOXYGENASE Compound PROTOCATECHUATE 3,4-DIOXYGENASE Source ORGANISM_SCIENTIFIC: Pseudomonas putida; Sequence M:  PAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIP QSISETTGPNFSHLGFGAHDHDLLLNFGLPIGERIIVAGR VVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNF GGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHF GISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQ LIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFE Description Functional site 1) chain M residue 324 type sequence Y description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 2) chain M residue 326 type sequence T description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 3) chain M residue 400 type sequence W description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 4) chain M residue 408 type sequence Y description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 5) chain M residue 447 type sequence Y description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 6) chain M residue 448 type sequence P description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 7) chain M residue 449 type sequence W description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 8) chain M residue 450 type sequence R description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 9) chain M residue 457 type sequence R description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 10) chain M residue 460 type sequence H description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 11) chain M residue 462 type sequence H description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 12) chain M residue 477 type sequence Q description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 13) chain M residue 491 type sequence I description SITE "ACA" IS THE ACTIVE SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : ACA 14) chain M residue 304 type sequence D description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 15) chain M residue 307 type sequence R description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 16) chain M residue 339 type sequence I description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 17) chain M residue 340 type sequence P description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 18) chain M residue 341 type sequence Q description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 19) chain M residue 342 type sequence S description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 20) chain M residue 343 type sequence I description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 21) chain M residue 344 type sequence S description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 22) chain M residue 345 type sequence E description SITE "VEA" IS THE VESTIGIAL SITE OF THE PROTOMER CONSISTING OF CHAINS A AND M. source : VEA 23) chain M residue 318 type sequence K description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 24) chain M residue 320 type sequence L description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 25) chain M residue 322 type sequence P description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 26) chain M residue 328 type sequence I description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 27) chain M residue 332 type sequence P description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 28) chain M residue 333 type sequence R description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 29) chain M residue 334 type sequence Q description SECONDARY THREE-FOLD SITE BETWEEN M, N, O CHAINS. source : S2M 30) chain M residue 408 type sequence Y description BINDING SITE FOR RESIDUE FE M 600 source : AC1 31) chain M residue 447 type sequence Y description BINDING SITE FOR RESIDUE FE M 600 source : AC1 32) chain M residue 460 type sequence H description BINDING SITE FOR RESIDUE FE M 600 source : AC1 33) chain M residue 462 type sequence H description BINDING SITE FOR RESIDUE FE M 600 source : AC1 34) chain M residue 361 type sequence H description BINDING SITE FOR RESIDUE BME M 601 source : AC7 35) chain M residue 429 type sequence C description BINDING SITE FOR RESIDUE BME M 601 source : AC7 36) chain M residue 430 type sequence L description BINDING SITE FOR RESIDUE BME M 601 source : AC7 37) chain M residue 438 type sequence S description BINDING SITE FOR RESIDUE BME M 601 source : AC7 38) chain M residue 324 type sequence Y description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 39) chain M residue 408 type sequence Y description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 40) chain M residue 447 type sequence Y description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 41) chain M residue 449 type sequence W description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 42) chain M residue 457 type sequence R description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 43) chain M residue 460 type sequence H description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 44) chain M residue 462 type sequence H description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 45) chain M residue 477 type sequence Q description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 46) chain M residue 491 type sequence I description BINDING SITE FOR RESIDUE FHB M 550 source : AC8 47) chain M residue 333 type sequence R description BINDING SITE FOR RESIDUE FHB M 551 source : AC9 48) chain M residue 322 type sequence P description BINDING SITE FOR RESIDUE FHB N 551 source : BC3 49) chain M residue 328 type sequence I description BINDING SITE FOR RESIDUE FHB N 551 source : BC3 50) chain M residue 448 type BINDING sequence P description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 51) chain M residue 461 type BINDING sequence I description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 52) chain M residue 463 type BINDING sequence F description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 53) chain M residue 409 type BINDING sequence R description BINDING => ECO:0000269|PubMed:7990141 source Swiss-Prot : SWS_FT_FI1 54) chain M residue 409 type catalytic sequence R description 936 source MCSA : MCSA1 55) chain M residue 448 type catalytic sequence P description 936 source MCSA : MCSA1 56) chain M residue 458 type catalytic sequence P description 936 source MCSA : MCSA1 57) chain M residue 461 type catalytic sequence I description 936 source MCSA : MCSA1 58) chain M residue 463 type catalytic sequence F description 936 source MCSA : MCSA1 59) chain M residue 380-408 type prosite sequence VAGRVVDQYGKPVPNTLVEMWQANAGGRY description INTRADIOL_DIOXYGENAS Intradiol ring-cleavage dioxygenases signature. VaGrVvdqyGkpVpntlVEMwqanagGrY source prosite : PS00083

Display surface Download Links